(data stored in ACNUC7421 zone)

EMBL: CP002343.PE412

CP002343.PE412       Location/Qualifiers
FT   CDS_pept        complement(463676..465085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0426"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_6360 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46974"
FT                   /db_xref="GOA:E6S870"
FT                   /db_xref="UniProtKB/TrEMBL:E6S870"
FT                   /protein_id="ADU46974.1"
FT                   /translation="MTGPVDVSALEVDDEDWLGQADWIVGGQAARAARKQGIYAGYVLV
FT                   LFAAVYGFPLVQALFRTSDRIWLREQLASAGGVLVLAGSVAAILGAGLWAGRFRGPVVP
FT                   PLPWIDLVVTAPVDRALAVRRWWRFAVVATVFVGAVVGLVLGSGLAFAEVTGVAAIAVA
FT                   TLAGAALGVLGARLWLWGQVRSWPGADRGVSVLWRVPDALRALHAESLRAHSANTSTLA
FT                   GSALTGNLRTARLAFARPVRRGRTARLRAGRPIRVLVRRDVLGLRRQPATVLAGAGLST
FT                   IGALVLVWGLTQPAAPAVALGVGMLPLYLGFGAWAEGLRLQADNVGTPSLIGVAAVPEA
FT                   VAHLVVPAVLTSGVLGGAAGLAALTTGLPPVALGVLAAVVPSVALLCGGHLLAAFRGAP
FT                   PTVSGPQGVVLWYLRPGLVVVVLGGVTSYALRGGHGVGSVTATLAICLVVAWGLATVRR
FT                   LTHLHRAFGAT"
     gtgacgggcc cggtcgacgt gtccgctctc gaggtcgacg acgaggactg gctgggacag        60
     gctgactgga tcgtcggcgg ccaggcggcc cgcgcggccc gcaagcaggg gatctacgcc       120
     ggctacgtgc tggtgctctt cgcggcggtc tacggcttcc cgttggtcca ggcgctcttc       180
     cggacgtccg accgcatctg gctccgggag cagctcgctt ccgctggtgg ggtcctggtc       240
     ctcgccggct cggtcgccgc gatcctcggc gcggggctct gggccggccg gttccggggc       300
     ccggtcgtgc cacccctgcc ctggatcgac ctcgtcgtga ccgctccggt cgaccgggcg       360
     ctggccgtgc ggcgatggtg gcgcttcgcc gtcgtggcga cggtcttcgt cggtgcggtg       420
     gtggggctcg tcctcggcag cgggctcgcg ttcgcggagg tcaccggggt cgctgccatc       480
     gcggtggcga ccctcgcggg cgccgcgctc ggggtcctcg gcgcgcggct gtggctctgg       540
     ggacaggtcc ggtcctggcc cggcgcggac cgtggagtct ccgtcctgtg gcgcgtgccc       600
     gacgccctgc gcgcactcca cgccgagtcg ctgcgagccc actcggccaa cacgtcgacc       660
     ctcgccggct cggcactgac cggcaacctc cgcacggcac ggctcgcgtt cgcccggccg       720
     gtccgaaggg gacgcacggc tcgcctgcgc gcgggccgtc cgatccgggt gctggtgagg       780
     cgcgatgtgc tcggactgcg tcgccagccg gccaccgtgc tcgcgggggc gggcctctcg       840
     accatcggtg ccctcgtgct ggtgtggggt ctcacccagc cggcggctcc ggcggtggcg       900
     ctcggggtcg ggatgctgcc gctctacctc ggcttcggcg cctgggccga gggcctgcgg       960
     ctccaggccg acaacgtcgg cacgccgtcg ctcatcgggg tcgcggccgt gcccgaggcg      1020
     gtcgcccatc tcgtcgttcc ggccgtcctg acgtcagggg tgctcggcgg cgccgcggga      1080
     ctggcggccc tgacgacggg gctgcccccg gtcgcgctcg gtgtcctggc cgcggtggtc      1140
     ccgtccgtcg ccctcctctg cggcggccac ctcctcgcgg ccttccgtgg ggcgccgccc      1200
     accgtgtcgg gaccgcaggg cgtggtcctg tggtacctgc gccccggcct ggtcgtcgtc      1260
     gtgctcggcg gcgtcacctc ctacgccctg cgagggggcc acggcgtggg gtccgtcacc      1320
     gcgacgctgg cgatctgcct cgtggtggcc tgggggttgg ccacggtgcg ccggctcacg      1380
     cacctgcacc gggcgttcgg ggcgacgtag                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page