(data stored in ACNUC7421 zone)

EMBL: CP002343.PE414

CP002343.PE414       Location/Qualifiers
FT   CDS_pept        466097..468436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0428"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /note="COGs: COG2812 DNA polymerase III gamma/tau subunits;
FT                   InterPro IPR003959: IPR003593: IPR012763; KEGG:
FT                   rsa:RSal33209_3356 DNA polymerase III subunits gamma and
FT                   tau; PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase; SPTR: DNA polymerase III subunits gamma and tau;
FT                   TIGRFAM: DNA polymerase III, subunits gamma and tau; PFAM:
FT                   ATPase family associated with various cellular activities
FT                   (AAA); DNA polymerase III subunits gamma and tau domain
FT                   III; TIGRFAM: DNA polymerase III, subunit gamma and tau"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46976"
FT                   /db_xref="GOA:E6S872"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S872"
FT                   /protein_id="ADU46976.1"
FT                   /translation="MATALYRRYRPESFAEVIGQEHVTEPLMQALRTGRVGHAYLFSGP
FT                   RGCGKTTSARILARCLNCEEGPTPTPCGVCQSCVALARGGPGSVDVIEIDAASHGGVDD
FT                   ARDLRERASYGPAQSRFKIYIIDEAHMVTPQGFNALLKIVEEPPEHVKFVFATTEPEKV
FT                   IGTIRSRTHHYPFRLVPPAKLSSYMESLLEQEHVAVAPGVLSFVVRAGGGSVRDSLSVL
FT                   DQLIAGSGPEGLTYESAVSLLGFTDGELLDATVDALAAADGAATFRQIDRVIESGLDPR
FT                   RFIEDLLERLRDLIIVAAVPEAGQVLRGVPEDQLERMRVQQAAFGPGALSRAADIANSG
FT                   LTEMTGATAPRMQLELICARILLPASSGEAGYGARLDRLERRLEVGGVPSQASSPDHQP
FT                   SRMPLGSPPPVPPVPAPQPPPSSVQDVSPPPPALRASSVQDVPPPPASSVQDVPAPGAG
FT                   RAPSRGPQSSTGGQQEPPPAPADPAPASAPASAGGMDTDAIRRAWPDVLGRIFSRRRIT
FT                   WTFVSQHAQVIGYDGTTLTLGIATAGLTNTFRSGNHAEIVRQALIDELGVDAVVDGIHA
FT                   SEVAPSEVAGSGHPTPATTATDAPGPITPGSHEGGPSGSPGPQRPSGPGGGGGAAGDLR
FT                   NAGGSAGAARAGASTLGVSPGAPPTTGRSLETNAGWGSVSAAAPDWATRPAGAAQTDLP
FT                   TAPPSGSARVATTGATSGASAVRESLGAARRGAHQPEGEPRAPQRPVTDDAAVSDDDED
FT                   IEISGDVGRAVIEKVLGGRVISELDD"
     atggccaccg ccctgtaccg ccgctaccgg ccggagagct tcgccgaggt catcgggcag        60
     gagcacgtca ccgagccgct gatgcaggcg ctgcgcacgg gccgggtggg gcacgcctac       120
     ctcttcagcg ggccccgggg ctgcggcaag accaccagcg cgcggatcct cgcccggtgc       180
     ctcaactgcg aggagggccc gacgcccact ccctgcggtg tctgccagtc ctgcgtcgcg       240
     ctcgcccgcg gaggccccgg cagcgtcgac gtcatcgaga tcgacgccgc cagccacgga       300
     ggcgtcgacg acgcgcgtga cctgcgcgaa cgggcctcgt acgggcccgc ccagagccgc       360
     ttcaagatct acatcatcga cgaggcgcac atggtcacgc cgcagggctt caacgccctg       420
     ctcaagatcg tcgaggagcc gcccgagcac gtgaagttcg tcttcgcgac gaccgagccg       480
     gagaaggtca tcgggaccat tcgctcccgc acccaccact acccgttccg gctcgtgccg       540
     ccggccaagc tgtccagcta catggagagc ctgctcgagc aggagcacgt ggcggtcgcc       600
     cccggcgtcc tgtccttcgt cgtgcgggcc ggcggcgggt cggtccgcga ctcgctctcg       660
     gtgctcgacc agctcatcgc cggctccggg cccgaggggc tgacctacga gagcgcggtg       720
     tcgctgctcg ggttcaccga cggggagctg ctcgacgcca cggtcgacgc gctcgcggcg       780
     gcggacgggg ccgcgacgtt ccgccagatc gaccgggtga tcgagtccgg cctcgacccg       840
     cggcggttca tcgaggacct gctcgagcgg ctccgtgacc tcatcatcgt ggccgcggtg       900
     cccgaggccg ggcaggtgct gcgcggcgtg ccggaggacc agctggagcg gatgcgcgtc       960
     cagcaggccg ccttcggccc cggggcgctc tcccgggcgg ctgacatcgc caactccggg      1020
     ctcaccgaga tgaccggcgc gacggcaccg cggatgcagc tcgagctcat ctgcgcccgg      1080
     atcctcctcc ccgcgtcgtc cggcgaggcc ggttacggcg cccggctcga ccggctggaa      1140
     cgccgtctcg aggtcggcgg ggttccgagc caggcgtcct ccccagacca ccaaccgagc      1200
     cgtatgccgc tgggctcgcc tccgcccgtc cccccggtcc cagcgccgca gcctcccccg      1260
     tcgagtgtgc aggacgtgtc gccgccgccc ccggccctgc gtgcgtcgag tgtgcaggac      1320
     gtgccgcccc cgccggcgtc gagtgtgcag gacgtgccgg cccccggcgc aggcagagcg      1380
     ccgtcgaggg ggccgcagtc gtcgacgggt ggtcagcagg aaccgccccc cgcccccgcc      1440
     gacccggcac ccgcgtccgc cccggcctcg gctgggggca tggacaccga cgcgatccgc      1500
     cgcgcctggc ccgacgtcct cggtcgtatc ttctcccgcc gccgcatcac gtggacgttc      1560
     gtctcccagc atgcccaggt catcgggtat gacggcacga cgctgaccct gggcatcgcc      1620
     acggcggggc tgacgaacac cttccggtcc ggcaaccacg ccgagatcgt ccgccaggca      1680
     ctcatcgacg agctcggcgt cgatgccgtc gtcgacggga tccacgcttc ggaggtcgcc      1740
     ccctcggagg tcgcaggctc cggccacccc acgcccgcga cgaccgcgac ggacgcgccc      1800
     ggtccgatca cgcccggttc gcacgaaggc ggcccgagcg gttcgcctgg cccgcagcgt      1860
     ccttcggggc ccgggggagg gggcggcgct gccggtgatc tccgcaacgc gggcgggtca      1920
     gcaggggcgg cccgcgcggg cgcttcgacg ctgggggttt cccccggtgc gccaccgacc      1980
     accggtcgct ccttggagac caacgcgggg tggggcagcg tcagcgccgc cgccccggac      2040
     tgggcgacgc ggcccgccgg tgcggcgcag accgatctgc cgaccgcgcc cccgagcggg      2100
     tccgcgcggg ttgcgacgac gggcgcgacc tctggggcga gcgccgtgcg cgagtcgctg      2160
     ggcgcggctc ggcgtggtgc gcaccagcca gagggggagc cgcgcgcccc gcagcgcccg      2220
     gtgaccgacg acgccgcggt cagcgacgac gacgaggaca tcgagatctc cggcgatgtc      2280
     ggacgtgccg tgatcgagaa ggtcctcggc ggacgagtca tctccgagct cgacgactga      2340
//

If you have problems or comments...

PBIL Back to PBIL home page