(data stored in ACNUC7421 zone)

EMBL: CP002343.PE415

CP002343.PE415       Location/Qualifiers
FT   CDS_pept        468506..469252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0429"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro IPR013216;
FT                   KEGG: nca:Noca_2043 methyltransferase type 11; PFAM:
FT                   Methyltransferase type 11; SPTR: Putative
FT                   methyltransferase, S-Adenosyl-L-methionine (SAM)-MTase
FT                   protein; PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46977"
FT                   /db_xref="GOA:E6S873"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6S873"
FT                   /protein_id="ADU46977.1"
FT                   /translation="MAADAYGRFMGRYSEPLAEQFVDWVGVRPGERALDVGSGPGALAA
FT                   RLVDRIGLTAVSAIDPSLPFVSALRARLPGLDVQSAGAERLPFPDDFFDHALAQLVVHF
FT                   MQDPATGIAEMARVTRPGGSVSSCVWDFAGGRAPLSTFWQAVTDLDPGARTEEDLPGAR
FT                   AGDLEGLLEAAGLTEIRSGELVVVVAQRSFEEWWEPYTFGVGPAGEHVASLTDNARDAL
FT                   RDHCRGLLQDAPFDVEATAWAASGTV"
     gtggcggctg acgcgtacgg gcgcttcatg ggccgctatt ccgagcctct cgcggagcag        60
     ttcgtcgact gggtcggggt ccgaccggga gagcgcgcgc tggacgtcgg cagcggtccc       120
     ggagcgctgg cggcccggct cgtcgaccgg atcggcctca ccgcggtctc tgcgatcgac       180
     ccgtcgctgc ccttcgtgag cgcgcttcgg gcccggttgc ccggcctcga cgtccagtcc       240
     gccggcgccg agcggctgcc cttcccggac gacttcttcg accatgcgct ggcgcagctc       300
     gtcgtccact tcatgcagga cccggccacc ggtatcgccg agatggcccg ggtgacgagg       360
     ccgggcgggt ccgtgtcgtc ctgcgtctgg gacttcgccg gaggtcgggc ccccctgtcg       420
     accttctggc aggcggtcac ggacctcgac ccgggtgcgc gcacggagga ggacctgccc       480
     ggggcccgcg ccggtgacct cgagggcctg ttggaggcag cgggcctcac ggagatccgg       540
     tccggagagc tcgtcgtcgt ggtcgcgcag cggagcttcg aggagtggtg ggagccgtac       600
     accttcggtg tcggacccgc cggagagcac gtcgcgtccc tcaccgacaa cgctcgagat       660
     gccctccggg accactgccg ggggctgttg caggacgcgc cgttcgatgt cgaggccacc       720
     gcgtgggccg cgagcggaac cgtctga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page