(data stored in ACNUC7421 zone)

EMBL: CP002343.PE417

CP002343.PE417       Location/Qualifiers
FT   CDS_pept        470037..470636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0431"
FT                   /product="DNA replication and repair protein RecR"
FT                   /note="COGs: COG0353 Recombinational DNA repair protein
FT                   (RecF pathway); InterPro IPR015967: IPR006171: IPR000093:
FT                   IPR006154; KEGG: bcv:Bcav_0549 recombination protein RecR;
FT                   PFAM: TOPRIM domain-containing protein; Zinc finger
FT                   C4-type, RecR; SMART: Toprim sub domain-containing protein;
FT                   SPTR: Recombination protein RecR; TIGRFAM: recombination
FT                   protein RecR; PFAM: Toprim domain; RecR protein; TIGRFAM:
FT                   recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46979"
FT                   /db_xref="GOA:E6S875"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:E6S875"
FT                   /protein_id="ADU46979.1"
FT                   /translation="MYEGAVQDLIDELGRLPGVGPKGAQRIAFHLLQADSDDVSRLVTA
FT                   LTEVKARVRFCEVCGNVAEAERCRICADSRRDHTAICVVEEPKDIVAIERTREFRGTYH
FT                   VLGGAISPIDGIGPDDLRVRELMQRLASGEVQEVIIATDPNLEGEATATYLSRLLRDVG
FT                   LTVTRLASGLPVGGDLEYADEVTLGRAFEGRRRVDA"
     gtgtacgaag gcgcggtcca ggacctgatc gatgagctcg gccgactccc cggcgtgggt        60
     cccaagggcg cgcagcgcat cgccttccac ctgcttcagg ccgactccga tgacgtctcc       120
     cgtctcgtca cggccctcac cgaggtcaag gcgagagtgc ggttctgtga ggtctgcgga       180
     aacgtggccg aggccgagcg ctgccggatc tgcgccgact cccgccggga ccacacggcg       240
     atctgcgtcg tggaggagcc caaggacatc gtggcgatcg agcgcacgcg agagttccgc       300
     ggcacctacc acgtcctggg cggcgcgatc agcccgatcg acggcatcgg cccggacgac       360
     ctgcgggtgc gtgagctcat gcagcgcctc gcctcggggg aggtgcagga ggtcatcatc       420
     gccaccgatc ccaacctcga gggtgaggcg accgcgacct acctgtcacg cctgttgcgc       480
     gacgtcggcc tgaccgtcac ccgcctcgct tccggcctgc cagtgggcgg cgacctcgag       540
     tacgcggacg aggtcacgct cgggcgcgcc ttcgagggcc gcaggcgggt cgacgcctga       600
//

If you have problems or comments...

PBIL Back to PBIL home page