(data stored in ACNUC7421 zone)

EMBL: CP002343.PE418

CP002343.PE418       Location/Qualifiers
FT   CDS_pept        470718..471368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0432"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kra:Krad_0464 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46980"
FT                   /db_xref="InterPro:IPR032025"
FT                   /db_xref="InterPro:IPR038312"
FT                   /db_xref="UniProtKB/TrEMBL:E6S876"
FT                   /protein_id="ADU46980.1"
FT                   /translation="MTTDDTTRDDAVPDDVATDSDSDTTAIEDGSAAADELSSLADLTA
FT                   QEASAFLTAITEVASGNSPDTAIPLLTLALSQILVAGARLGAIQDVVLLERYEADPGPD
FT                   DDPDPLRDGLANLLTGIDDYVYVVDPVTSPERVGGSITNDLADIALALTHGLKHYANGR
FT                   TVEALWWWQFSYLSSWGDRALASMRALHSILSHLRLDADDERVAEAEFDALHP"
     atgaccaccg acgacaccac gcgtgatgac gcggtgcccg acgacgtcgc tacggactca        60
     gacagcgaca ccacggccat cgaggacggg agtgccgccg ccgacgagct gagcagcctc       120
     gcggacctga ccgcgcagga ggcgagcgcc ttcctcaccg ccatcacgga agtcgcttcc       180
     ggcaactcgc cggacacggc catccccttg ctcaccctcg cgctgtccca gatcctcgtg       240
     gccggggcgc ggctcggagc catccaggat gtcgtcctcc tggaacgcta tgaggcggac       300
     ccgggtcctg acgacgaccc cgaccccttg cgtgacggac tcgcgaacct gctcaccggc       360
     atcgacgact acgtctatgt ggtggacccg gtgacctccc ccgagcgggt cggcggctcg       420
     atcacgaacg acctggccga catcgccttg gctctcactc acgggctcaa gcactacgcg       480
     aacggacgga ccgtggaggc gctctggtgg tggcagttca gctacctgtc gtcctggggc       540
     gaccgcgcgc tggcgtcgat gcgggcactg cactcgatcc tgtcccatct gcgcctggac       600
     gccgatgacg agcgggtggc tgaggcggag ttcgacgccc tgcacccctg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page