(data stored in ACNUC7421 zone)

EMBL: CP002343.PE419

CP002343.PE419       Location/Qualifiers
FT   CDS_pept        471576..472334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0433"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="InterPro IPR001387; KEGG: bcv:Bcav_3642
FT                   transcriptional regulator, XRE family; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein; SPTR: Transcriptional regulator, XRE
FT                   family; PFAM: Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46981"
FT                   /db_xref="GOA:E6S877"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6S877"
FT                   /protein_id="ADU46981.1"
FT                   /translation="MPSASVSRHQPEPLGPLGPLESPDPPAATDLSRVSEVSGLIVRAR
FT                   RRGDLSQRDLATAVGVSQSTIAALETGDREPALALFLRILAEGGLRLAVVDSSGKEVRP
FT                   VASDTVRDNAGRRLPAHLDADPPDRKPWYRLREERDRVRAGAAQDPRLLPDHPTHAELE
FT                   ARRRQQLYGARPPAPGSDRDAGYLECECETECWLGTACPPQCLCQCETTPRLDPCQGRI
FT                   RVSHDSDAIGGSPTSAIDCELRTPGSREPQ"
     atgccatctg ccagtgtttc tcgccatcag cccgagcccc tcggacccct cggacccctc        60
     gagtccccgg accctccggc ggcgacggac ctgagccgcg tctccgaggt gagcggcctc       120
     atcgtgcgtg cgcgtcgtcg aggtgacctc agccaacggg acctcgccac cgccgtcgga       180
     gtgtctcagt cgacgatcgc cgccctggag acgggcgatc gcgaacccgc gttggcgctc       240
     ttcctccgga tcctcgccga gggtgggcta cgtctcgctg tcgtcgactc atcggggaag       300
     gaggtgcgcc cggtcgcctc ggacaccgtc cgggacaacg cggggaggag gctgcccgcg       360
     cacctcgacg ccgacccgcc ggaccgcaag ccgtggtacc gcctgcgtga ggaacgcgac       420
     cgggtccgcg ccggtgcggc gcaggatccc cgccttctcc ccgaccaccc gacgcatgcc       480
     gagctcgagg cgcgtcgcag gcaacagctg tacggcgcgc ggccgcccgc ccctgggtcg       540
     gaccgggacg ccgggtacct cgagtgcgag tgcgagaccg agtgctggct cgggaccgcc       600
     tgcccaccgc aatgcctgtg ccagtgcgag acgactcccc gcctcgaccc ctgccagggt       660
     cgaatccgcg tgtctcacga ttccgacgcc atcgggggaa gcccgaccag cgcaatagac       720
     tgcgagctcc gcactccagg atcccgggag ccacagtga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page