(data stored in SCRATCH zone)

EMBL: CP002343.PE421

CP002343.PE421       Location/Qualifiers
FT   CDS_pept        473687..473953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0435"
FT                   /product="sterile alpha domain containing 1"
FT                   /note="KEGG: hsa:90378 sterile alpha motif domain
FT                   containing 1; SPTR: Atherin"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46983"
FT                   /db_xref="UniProtKB/TrEMBL:E6S879"
FT                   /protein_id="ADU46983.1"
FT                   /translation="MTPDEPKLLPDGRVFPPVTPDPPPPPGQEEIIVPDLDFGSAAEAA
FT                   VGSAAEAAKEPGDEPRDEAPHTAPDTAPDPQDGSEPPAGEPTA"
     atgacccccg acgaaccgaa gctccttccc gacggtcgcg tcttcccgcc ggtgacgccg        60
     gacccgccgc cacctcccgg ccaggaggag atcatcgttc ccgacctcga cttcgggtcc       120
     gccgccgagg ccgcggtcgg ctcagcagcc gaggccgcga aggagccggg ggacgagccg       180
     cgggacgaag cgccccacac ggcgcccgac acggcgcccg acccccagga cgggtcagag       240
     ccccccgcgg gtgagccgac ggcgtga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page