(data stored in ACNUC7421 zone)

EMBL: CP002343.PE423

CP002343.PE423       Location/Qualifiers
FT   CDS_pept        474502..475191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0437"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amd:AMED_6555 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46985"
FT                   /db_xref="GOA:E6S881"
FT                   /db_xref="UniProtKB/TrEMBL:E6S881"
FT                   /protein_id="ADU46985.1"
FT                   /translation="MTGQRQREFLKDNALSLAFLLLLLLSLAGQALSGVAEYNDQARTA
FT                   QLQEISVWRYVTSSRFAVDTAENWQSEYLQFAVFIFLTIWLVQRGSSESKKPGEEGRES
FT                   DKKQLLGRYVRDDSPPWARAGGWRTALYSHSLLVIMTTIFVLSWTAQAIAGRVASNEER
FT                   MRELLEPQTLGQYVTSPDFWSRTFQNWQSEMLAIASMAILSIYLRERGSPESKPVGMPH
FT                   DETSADD"
     atgacggggc agagacagcg agaattcctc aaggacaacg ccctgtccct ggcctttctc        60
     ctccttctcc tgctcagcct ggcgggtcag gcgctgtcgg gcgtcgctga gtacaacgac       120
     caggcccgca cggcgcagct gcaggagatc tcggtgtggc ggtacgtcac atcgtcccgc       180
     ttcgcggtgg acaccgcgga gaactggcag tcggagtacc tccagttcgc agtcttcatc       240
     ttcctgacga tctggctcgt ccagcggggc tcctccgagt cgaagaagcc cggcgaagag       300
     ggccgggagt ccgacaagaa gcagctgctg gggcgctatg tccgggacga ctcgcccccg       360
     tgggcgcgag cgggagggtg gcgcaccgcg ctctactccc actcgctgct cgtcatcatg       420
     acgacgatct tcgtgctctc gtggacggcc caggccatcg ccggtcgagt cgcctccaac       480
     gaggagcgga tgcgcgagct cctcgagccg cagacgctcg ggcagtacgt gacctcaccg       540
     gacttctgga gcaggacgtt ccagaactgg cagtccgaga tgctggccat tgcgagcatg       600
     gcgatcctgt cgatctacct gcgcgagcgg gggtcccccg agtcgaagcc ggtcggcatg       660
     ccgcacgacg agacgtccgc cgacgactga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page