(data stored in ACNUC7421 zone)

EMBL: CP002343.PE424

CP002343.PE424       Location/Qualifiers
FT   CDS_pept        complement(475256..478528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0438"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR005467: IPR001789: IPR000014: IPR000700: IPR
FT                   005561: IPR013656: IPR003661: IPR003594: IPR013767:
FT                   IPR004358; KEGG: ami:Amir_3954 multi-sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   PAS fold-4 domain protein; response regulator receiver; PAS
FT                   fold domain protein; ANTAR domain protein; SMART: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; SPTR:
FT                   Multi-sensor signal transduction histidine kinase; TIGRFAM:
FT                   PAS sensor protein; PFAM: Histidine kinase-, DNA gyrase B-,
FT                   and HSP90-like ATPase; Response regulator receiver domain;
FT                   ANTAR domain; His Kinase A (phosphoacceptor) domain; PAS
FT                   fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46986"
FT                   /db_xref="GOA:E6S8L7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8L7"
FT                   /protein_id="ADU46986.1"
FT                   /translation="MTAAPRVPGREIAPDHPGELGARFATIDWSHTPLGPISEWPTELR
FT                   GAVSICLTSRFPMLVWWGPQYVMIYNDGYRPMLGRLKHPAALGSAGKEVWPEIWATIGP
FT                   MLDRVMETGVATWSRDQKLILERNGYPEECYFTFSYSPITSEAGEVGGVFTAVTETTDH
FT                   VLSERRLGTLGVLARRLGEATDAEHVRRLAAEVLLSNPQDHPVVAMVDAAALPDDPRDL
FT                   DVPEELRADVLAAATQAATLQHQVHHDLPSPVHLHDSGLSVAGLHALPIALPGDEELSE
FT                   VLVVGRSSQRTWEPALATYLALCVTHLGTALSAIRTLDTERQRAETLEVLDAAKSSFFT
FT                   NVSHELRTPLTLIAGPVAEALGDPGLTPEQRERLDLVQRNTVRLTRMVDAMLDFGRMAA
FT                   NKLQPLPEPLDVALQTRTMADSFTQAFDRAGLDFVVDCDHAPRTAHLDRDMYERVVLNL
FT                   LSNALKYTPAGSVRLRLECSADGFAVSVADTGIGIRRRDLARIFERFEQLPRRGRARFQ
FT                   GGAGIGLAMVKQLTELMGGSVDVESTLGRGSTFTIRLPWGTPPVESAEPADGRSITPRN
FT                   ADAFLAEAEGWYEPYAAEPAPRTSRPPAVAGSPAGSVPDGAAARPRLLVAEDNRDMRTY
FT                   LRGALESDYDVEMVPDGTTALQRAVASRPDIVLADAMMPGLDGFALTRAIRMNAAVRDV
FT                   PVIILSARAAESDTTEGLTSGADDYVSKPFSVGDLKARLASNLERSRARLRDAAWRRAV
FT                   MESFQDALLITDAEGEVVEVNDAFTQLLGFSADDGPFSVPHPWWPAVQTPTGVAEVDAV
FT                   DVPPTDRANVEQLLAQALQGATITGRECRLVTKDHRDVWVRLSTREVESVGGQPNYVVM
FT                   SLQDVTREHAARARRQAAAALSAEFGRAEDLEQVLEAAVTGFADLFDGDSTVRALAGPE
FT                   EHVFTAAGPVRRADLDDTLWELLTAIEPEVPAPSDRVPGLLISPQNHPSSECRVWVQFR
FT                   RPRRVATDERIVGDLLGQAFALAVDRVVAATAFADRESHLSRAIESHRMIGQAIGILIE
FT                   RHRVTPAEAFTRLKQASQARNIKLREIASRVIETGAEPDEAD"
     atgaccgcag cacctcgcgt gcctggacgc gagatcgctc ctgaccatcc cggagagctc        60
     ggcgccaggt ttgccaccat cgactggtcg cacacgccgc tgggcccgat ctccgaatgg       120
     ccgacggagc tgcgcggggc cgtgagcatc tgcctcacct ccaggttccc gatgctcgtc       180
     tggtggggac cgcagtacgt catgatctac aacgacggct accgccccat gctcggcagg       240
     ctgaagcacc ctgccgcgtt gggcagcgcc ggcaaggagg tctggccgga gatctgggcc       300
     accatcgggc cgatgctcga ccgggtcatg gagacggggg tcgcgacgtg gtcccgcgac       360
     cagaagctca tcctcgagcg caacggttac cccgaggagt gctacttcac cttctcgtac       420
     agccccatca ccagcgaggc cggcgaggtc ggcggggtct tcaccgcagt caccgagacg       480
     accgaccacg tgctgagtga gcggcgcctc ggcaccctcg gggtcctcgc gaggcggctc       540
     ggtgaggcga ccgacgccga gcacgtgcgg cgcctcgcgg ccgaggtgct cctgtcgaac       600
     ccccaggacc accccgtcgt cgccatggtc gacgctgcgg cgctgcccga cgacccccgc       660
     gacctcgacg tcccggagga gctgcgcgcg gacgtgctcg ccgcggcgac ccaggcggcc       720
     acgctccagc accaggtcca ccacgacctg ccgagccccg tccacctgca cgacagcggc       780
     ctgtcggtgg ccgggctcca cgccctgccg atcgccctcc ccggtgacga ggagctgtcc       840
     gaggtcctcg tcgtcggccg ctcctcccag cgcacctggg agcccgccct cgcgacctac       900
     ctggcccttt gcgtcacgca cctgggcacg gcgctgagcg cgatccgcac gctcgacacc       960
     gaacgtcagc gggccgagac cctcgaggtg ctcgacgccg ccaagagctc cttcttcacc      1020
     aacgtcagcc acgagctgcg gaccccgctc acgctcatcg ccggccccgt cgccgaggcg      1080
     ctcggcgacc ccggtctgac cccggagcag cgcgagcgcc tcgacctcgt ccagcgcaac      1140
     accgttcggc tgacccgcat ggtcgacgcc atgctcgact tcggtcggat ggcggccaac      1200
     aagctccagc ccctgccgga gccgctcgac gtggcgctcc agacccggac gatggccgac      1260
     tccttcacgc aggccttcga ccgcgccggg ctggacttcg tcgtcgactg cgaccacgct      1320
     ccgcggaccg cccacctcga ccgggacatg tacgagcggg tcgtgctcaa cctgttgagc      1380
     aacgccctga agtacacccc cgccggcagc gtccggctgc ggctcgagtg cagcgccgac      1440
     ggtttcgccg tatcggtcgc cgacacgggc atcggcatcc gccgtcgcga cctcgcccgg      1500
     atcttcgagc gtttcgagca gctgccccgg cgcggcaggg cccgcttcca ggggggcgcc      1560
     gggatcggcc tcgccatggt gaagcagctg accgagctga tgggcggctc cgtcgacgtg      1620
     gagtccaccc tcggccgcgg gtcgaccttc accatccgcc tgccctgggg caccccgccc      1680
     gtcgagtccg ccgagccggc cgacggccgt tccatcaccc cgcgcaacgc cgacgccttc      1740
     ctcgccgagg cggagggctg gtatgagccg tatgccgctg agcccgctcc ccgaacctcc      1800
     cgacctcccg ctgtggcggg gtcacccgcc ggcagtgtgc cggacggcgc tgcggcccgg      1860
     ccccggctgc tcgtggcgga ggacaaccgc gacatgcgga cctatctgcg cggcgcgctc      1920
     gagtcggact acgacgtgga gatggtgccc gacggcacga ccgcgctcca gcgggccgtc      1980
     gcctcgcgcc ccgacatcgt cctggccgac gcgatgatgc ccgggctcga cggcttcgcg      2040
     ctgacgaggg cgatccggat gaacgccgcc gtgcgcgatg tccccgtcat catcctgtcg      2100
     gcgcgggcag cggagagcga caccaccgaa ggcctcacct ccggtgccga cgactacgtc      2160
     tccaagccgt tctcggtcgg cgacctgaag gcccggctcg cgagcaacct cgagcggtcc      2220
     cgggcccggt tgcgggacgc ggcgtggcgc cgggccgtga tggagtcgtt ccaggacgcc      2280
     ctgctcatca cggatgccga aggtgaggtc gtcgaggtca acgatgcctt cacccagctg      2340
     ctcggcttct ccgccgacga cgggccgttc tccgttccgc acccgtggtg gccggcggtg      2400
     cagaccccga ccggggttgc ggaggtcgac gcggtcgatg tgccgccgac ggaccgcgcg      2460
     aacgtcgaac agctcctggc gcaggcgctg cagggggcga ccatcaccgg gcgcgagtgc      2520
     cggctcgtca ccaaggatca ccgggacgtc tgggtgcggc tgagcacgcg cgaggtcgag      2580
     agcgtcggcg gccagcccaa ctacgtcgtg atgtcactcc aggacgtcac ccgggagcat      2640
     gccgctcgag cgcgccgcca ggccgccgcg gccctgtccg ccgagttcgg gcgcgccgag      2700
     gacctcgagc aggtgctcga ggccgcggtg accggcttcg ccgacctgtt cgacggcgac      2760
     tccacggtcc gcgccctcgc cgggccggag gagcacgtgt tcacggcggc gggcccggtg      2820
     cgtcgcgccg acctggacga cacgctgtgg gagctgctca cggccatcga gccagaggtg      2880
     ccggcgccga gcgaccgcgt ccccgggctg ttgatcagcc cgcagaacca cccctcttcc      2940
     gagtgccggg tctgggtgca gttccggcgc ccccgccggg tcgcgaccga cgagcggatc      3000
     gtcggcgacc tgctcggtca ggctttcgcg ctcgccgtgg accgggtcgt ggcggcgacg      3060
     gccttcgctg accgggagtc gcacctgtcc cgggccatcg agagtcaccg gatgatcggc      3120
     caggccatcg gcatcctcat cgaacgtcac cgggtgactc ccgccgaggc gttcacgagg      3180
     ctcaagcagg cctcccaggc ccggaacatc aagctgcgcg agatcgcctc gcgagtcatc      3240
     gagaccgggg cggagccgga cgaggccgac tga                                   3273
//

If you have problems or comments...

PBIL Back to PBIL home page