(data stored in ACNUC7421 zone)

EMBL: CP002343.PE425

CP002343.PE425       Location/Qualifiers
FT   CDS_pept        complement(478648..479211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0439"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_3999 hemerythrin HHE cation
FT                   binding domain-containing protein; SPTR: Hemerythrin HHE
FT                   cation binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46987"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8L8"
FT                   /protein_id="ADU46987.1"
FT                   /translation="MSSLHSLLSVLQRQHAHIGMLLSRVGDSSGTARHGAVADLLQYVA
FT                   LHESAEQTFMHPVALKSVGDVAAVQGRVVEEREIEAVITRLEGLDPASMDFMIYFGLLE
FT                   EAMSGHTRAEENVEARVLGAVPDHELEHMARGIGLVDVWMDPAARLIGGSVASMPLRPG
FT                   PRDVGFSELHRRSLEAFDAVFRLR"
     atgtcctcgc tgcacagcct cctcagcgtg ctgcagcgcc agcacgcgca catcggcatg        60
     ctgctttcca gggtgggtga ctcctccggc accgctcgac acggggcggt cgccgacctg       120
     ctccagtacg tcgccctcca cgagtccgcc gagcagacct tcatgcaccc ggttgcgctc       180
     aagtccgtgg gagacgtggc ggcggtccag ggtcgggtcg tcgaggaacg cgagatcgaa       240
     gcggtcatca cgcgtctcga gggcctggac cccgcctcga tggacttcat gatctacttc       300
     ggcctcctcg aggaggccat gagcggccac acccgcgcgg aggagaacgt ggaggcccgc       360
     gtgctcggcg ccgtcccgga ccacgagctg gaacacatgg cgcgcgggat cgggctggtc       420
     gacgtgtgga tggatcccgc cgcccgcctc atcggcggct cggtggcgag catgccactg       480
     cggccgggtc ccagggacgt cggcttcagc gagttgcacc gtcgcagcct cgaggcgttc       540
     gacgccgtct tccgacttcg ctga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page