(data stored in ACNUC7421 zone)

EMBL: CP002343.PE426

CP002343.PE426       Location/Qualifiers
FT   CDS_pept        479306..480343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0440"
FT                   /product="DNA topoisomerase IB"
FT                   /note="COGs: COG3569 Topoisomerase IB; InterPro IPR001631;
FT                   KEGG: amd:AMED_4291 DNA topoisomerase IB; SPTR: Putative
FT                   uncharacterized protein; PFAM: Eukaryotic DNA topoisomerase
FT                   I, catalytic core"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46988"
FT                   /db_xref="GOA:E6S8L9"
FT                   /db_xref="InterPro:IPR001631"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR035447"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8L9"
FT                   /protein_id="ADU46988.1"
FT                   /translation="MRLRRSDPGKPGLRRVRRGKGFVVVDTEGRRVDADTMARVKALVI
FT                   PPAWEDVWVCPWPNGHIQAVGTDAAGRRQYLYHPAWHETRDRVKHERVVTLARRLPEAR
FT                   AEISRRLRRPGLGRERVGAVALRLLDAGLFRTGGEEYETENGSHGVATLRKDHVSVRGD
FT                   VVSFCFPAKSGVEREAEVRDPALAKAVASLKRSRGPSERLLQYRTEGGAWCELTSTEIN
FT                   RDFKELVGDDYTVKDLRTWAGTVLAAAAFAERADHGPPASERVRKKVEREVMTLVSEHL
FT                   GNTPAVARRSYVDSRVPDEYAAGRTIARALARASAADRRRLRRGDLAEVTDRAALERAL
FT                   VRLLS"
     atgcggctga ggaggagtga tccgggcaag cccggactga ggcgggtgcg ccgcggcaag        60
     ggtttcgtcg tcgtcgacac tgagggacgc cgcgtcgacg cggacacgat ggctcgggtc       120
     aaggcgctgg tcatcccgcc cgcgtgggag gacgtctggg tgtgcccgtg gcccaacggt       180
     cacatccagg ccgtggggac cgacgcagcc gggcggaggc agtacctcta ccacccggct       240
     tggcacgaga cgcgggaccg ggtcaagcac gagcgtgtcg tcacgttggc gcgacgcctc       300
     ccggaggcgc gggccgagat cagccggcgg ttgcggcgac ccgggctggg gagggagcgg       360
     gtcggcgccg tcgcgctccg cctcctcgac gcggggctct tccggaccgg gggcgaggag       420
     tacgagaccg agaacggcag ccacggcgtc gccacgctgc gcaaggacca tgtcagcgtc       480
     cggggggacg tcgtgtcgtt ctgcttcccc gcgaagtccg gggtcgagcg ggaggccgag       540
     gtccgcgacc cggcgctcgc caaggccgtc gcgtccctca agcgcagccg tgggccgagc       600
     gagcggctgc tccagtaccg gaccgagggc ggcgcgtggt gcgagctgac ctcgacggag       660
     atcaacaggg acttcaagga gctggtcggt gacgactaca ccgtcaagga cctccgcacg       720
     tgggcgggca cggtgctcgc ggctgcggcc ttcgccgagc gggccgacca cggtccgccg       780
     gcgtccgagc gggtccgcaa gaaggtcgag cgcgaggtga tgacgttggt gtccgagcac       840
     ctcggcaaca cgcccgccgt cgcacgccgg tcctacgtcg acagcagagt ccccgatgag       900
     tatgccgctg ggcgcacgat cgctcgggcg ctcgctcggg cctcggctgc agatcgcaga       960
     cggttgcgtc gtggagacct cgcggaggtc accgaccggg ccgccctgga gcgggcgctc      1020
     gtgcgcctgc tgtcctga                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page