(data stored in ACNUC7421 zone)

EMBL: CP002343.PE427

CP002343.PE427       Location/Qualifiers
FT   CDS_pept        480708..482312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0441"
FT                   /product="amine oxidase"
FT                   /note="COGs: COG1233 Phytoene dehydrogenase and related
FT                   protein; InterPro IPR002937: IPR006076; KEGG: nml:Namu_3691
FT                   FAD dependent oxidoreductase; PFAM: amine oxidase; FAD
FT                   dependent oxidoreductase; SPTR: FAD dependent
FT                   oxidoreductase; PFAM: Flavin containing amine
FT                   oxidoreductase; FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46989"
FT                   /db_xref="GOA:E6S8M0"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8M0"
FT                   /protein_id="ADU46989.1"
FT                   /translation="MVGSGPNGLVAANLLADAGWRVVVLEAQDEPGGAVKSAEDVRPGW
FT                   VHDTFSSFYPLAAASPTIQGLGLERHGLEWVRAPASVGHPLPGGRWAVVHPRPEDTAAA
FT                   LDRLHPGDGEAWLRVCALWDRVGADLVGALLTPFPPLRAGLRLGAKVPRLGGLAFAREL
FT                   LLPVRRLGDEWFGGEGPKLLLAGNAAHADIAMDAPGSGLLGLLLAMLGQSHGFPVPRGG
FT                   AGRLTAALVARFESLGGEIRTGVRVNQVEVRSGRAVGVRLGDGEHIRATRAVVADVSAP
FT                   ALFGGLVPWSQLPDRLRRRMRSFEWDAGTVKIDWALSGPVPWASAPELTPGTVHLADSV
FT                   GDLAIAGAQLASGRVPDRGLVILGQMAATDPTRAPRGSESLWAYLHVPQRRSRADQAHP
FT                   EPVDEPRAELVAHQVEERIEEYAPGFRDRVLDRRVLGPAELERRNENLVGGAVNGGTAA
FT                   IHQQLFWRPVPGWGRPETPVQGLYLASASAHPGGGVHGACGSNAARAALAHDRLERLTA
FT                   RRIRPVGPGPRLGRRQP"
     gtggtcggca gcggtccgaa cgggctcgtc gccgccaacc ttctcgccga tgccggttgg        60
     agggtcgtcg tcctcgaggc gcaggacgag ccgggcggag cggtgaagag cgccgaggac       120
     gtgcgacccg gctgggtgca cgacacgttc agctcgttct acccgctggc cgcggcgtcc       180
     ccgacgatcc aggggctggg tctcgagcgc catgggctgg agtgggtccg agcgcccgcg       240
     tccgtggggc atccgctgcc gggaggccgg tgggcggtgg tccatccgcg gcccgaggac       300
     accgccgccg ccctcgaccg gctgcacccc ggcgacgggg aggcgtggtt gcgggtctgc       360
     gccctctggg accgggtcgg cgctgacctc gtcggtgcgc tgctgacacc gttcccgccg       420
     ctgcgggccg ggctccgcct cggcgcgaag gtcccgcgac tggggggtct cgctttcgcg       480
     cgagagctgc tgttgccggt gcggcgcctc ggcgacgagt ggttcggcgg cgaggggccg       540
     aagctgctgc tggccggcaa cgccgcacac gccgacatcg cgatggacgc ccccgggtcg       600
     ggtctgctgg gcctgctgct cgcgatgctc ggccagagcc acggcttccc ggtcccgcgc       660
     ggcggcgccg gacgactcac tgcagccctc gtcgccaggt tcgagtcgtt gggcggggag       720
     atccggaccg gtgttcgcgt caaccaggtg gaggtccggt ccggtcgggc agtcggggtg       780
     cggttgggcg acggcgagca catccgtgcc actcgggcgg tcgtcgctga cgtcagcgcc       840
     ccggctctct tcggcgggct cgtcccctgg tcgcagctgc cggaccgact ccggcgacgg       900
     atgcggtcgt tcgagtggga cgccgggacc gtcaagatcg actgggctct gagcgggccg       960
     gtcccgtggg ccagcgcccc ggagctcacc cccggcaccg tccacctcgc cgacagcgtc      1020
     ggcgacctcg ccatcgccgg tgctcagctc gcgtcgggtc gcgtccccga tcggggcctg      1080
     gtgatcctcg gccagatggc cgcgaccgac ccgactcgag cgccacgggg aagtgagtcc      1140
     ctctgggcgt acctccacgt cccgcagcgc cggtcccgcg ccgaccaggc ccaccccgag      1200
     ccggtcgacg agccgcgtgc cgagctggtg gcccaccagg tcgaggagcg gatcgaggag      1260
     tatgccccgg gcttccggga ccgggtcctc gaccgacggg tgctgggacc ggccgagctg      1320
     gagcgccgca acgagaacct cgtcggaggt gcggtcaacg gcggcacggc ggcgatccac      1380
     caacagctct tctggcggcc cgtgcccggc tggggccgcc cggagacgcc ggtccaaggg      1440
     ctctatctgg cctcggcctc cgcccacccg gggggtggcg tgcacggagc gtgcgggtcg      1500
     aacgcggcgc gcgccgccct cgcccatgac cgtctcgagc ggctcaccgc ccgtcgcatc      1560
     cgcccggtgg gtccgggccc ccggctgggt aggagacaac catga                      1605
//

If you have problems or comments...

PBIL Back to PBIL home page