(data stored in ACNUC7421 zone)

EMBL: CP002343.PE428

CP002343.PE428       Location/Qualifiers
FT   CDS_pept        482309..482779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nml:Namu_2441 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Polyketide cyclase
FT                   / dehydrase and lipid transport"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46990"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8M1"
FT                   /protein_id="ADU46990.1"
FT                   /translation="MSRTTRLMSCSPDDVFEILADGWSFASWVVGAARIREVDATWPQS
FT                   GSRIHHSVGLWPALIDDTTSVLHLDRPHALELKVRAWPTGEGKVRLECVPEEGGTRVIM
FT                   TEDATKGPATLVPRLVRDPVLDARNTEALRRLAYLAERKAAESRPAKRVEKS"
     atgagccgca cgacccgcct catgagctgc agtccggacg acgtcttcga gatccttgct        60
     gacggctgga gcttcgcgtc ctgggtcgtc ggggcagcgc ggatccgcga ggtcgacgcc       120
     acctggccgc agtcgggcag tcggatccac cactcggtcg gcctctggcc ggccctcatc       180
     gacgacacga cgtcggtgct ccatctggac cgaccgcacg cgctcgagct caaggtccgc       240
     gcctggccga cgggcgaggg caaggtgcgc ctcgagtgcg ttcccgagga gggtggcacc       300
     cgcgtcatca tgaccgagga cgcgacgaag gggcccgcca ccctggtgcc ccgcctcgtc       360
     cgggacccgg tgctcgacgc ccgcaacacc gaggcgctcc gacggctcgc ctacctcgct       420
     gaacgcaagg ccgccgagtc ccggcccgcg aagcgggtag agaagtcgta a                471
//

If you have problems or comments...

PBIL Back to PBIL home page