(data stored in SCRATCH zone)

EMBL: CP002343.PE429

CP002343.PE429       Location/Qualifiers
FT   CDS_pept        482862..483326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0443"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="InterPro IPR012312; KEGG: nda:Ndas_5558 hemerythrin
FT                   HHE cation binding domain protein; PFAM: Hemerythrin HHE
FT                   cation binding domain protein; SPTR: Hemerythrin HHE cation
FT                   binding domain protein; PFAM: Hemerythrin HHE cation
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46991"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8M2"
FT                   /protein_id="ADU46991.1"
FT                   /translation="MSGVITLIKEDHQKLESVFKKLEKAEPQEIPGLLRQVQELLVPHS
FT                   KAEEKVVYPAIRSTVPDESSDIEDGLEEHHHVEETLEQLLASDPEAPGVDGLIAAMIGE
FT                   VRHHVEEEEEQILPAFGDAASNQQLSDLGEQFTAAKEEELRALKAGSAGA"
     atgtccggtg tcatcacgct gatcaaggaa gaccaccaga agctcgagtc cgtcttcaag        60
     aagctcgaga aggcggagcc gcaggagatc ccgggcctgc tccgacaggt gcaggagctg       120
     ctcgtcccgc actccaaggc agaggagaag gtggtctacc cggcgatcag gtcgaccgtt       180
     ccggacgagt cgtccgacat cgaggacggc ctcgaggagc accaccacgt cgaggagacg       240
     ctcgagcagc tgctcgcctc cgacccggag gctcccggcg tcgacggcct catcgccgcg       300
     atgatcggcg aggtccgtca ccacgtggag gaggaggagg agcagatcct tcccgccttc       360
     ggtgacgcgg cgagcaacca gcagctgagc gacctcggcg agcagttcac cgccgccaag       420
     gaagaggagc tgcgggccct caaggcgggc tccgcgggcg cgtga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page