(data stored in ACNUC7421 zone)

EMBL: CP002343.PE43

CP002343.PE43        Location/Qualifiers
FT   CDS_pept        47051..48340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0043"
FT                   /product="HipA N-terminal domain protein"
FT                   /note="COGs: COG3550 conserved hypothetical protein;
FT                   InterPro IPR012894: IPR012893: IPR017508; KEGG:
FT                   mva:Mvan_1137 HipA domain-containing protein; PFAM: HipA
FT                   domain protein; SPTR: HipA domain protein; TIGRFAM: HipA
FT                   N-terminal domain protein; PFAM: HipA-like C-terminal
FT                   domain; HipA-like N-terminal domain; TIGRFAM: HipA
FT                   N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46605"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEK4"
FT                   /protein_id="ADU46605.1"
FT                   /translation="MNEMNVFLDGALAGRLEQTTGGSLSFSYDAAYTSRPSPTPLSLSM
FT                   PLSSARHSSRVVTAWLEGLLPDNAAVREEWGRRFQVSARNPFALLRHVGRDAAGGVQVL
FT                   PVDVDPPDAALRTGDVRRLSEEQLCSMLRELTVRDAGWEVGEGSGRWSLAGAQNKVALH
FT                   LLDDGTWGVPNDSTPTTHILKPTASGTRFGDLQVNEFVCLRAAAVLGLRVAHVELVDFG
FT                   GAKTLVSTRYDRRRDRNGTWLRLHQEDLLQAMTYPPSKKYQADKGPSVKNVAALLGSLG
FT                   LADRSPVRERFFDAFAFNTLVGGTDAHAKNYSLLLRGPRVALAPLYDAASYAPYLKPGE
FT                   VVHSSMKVGKAWQVRDVTVEDWVEVATALELAPDYALDRVEHLRTGMAGAVSEAADQAP
FT                   APFAKAARQVATAVAKQRHLRVPRLPRARR"
     atgaacgaga tgaacgtctt cctcgacgga gccctggccg gccgactgga gcagacgacc        60
     ggtggatcgc tgtccttctc ttacgatgct gcctacacct cccgtccctc accgacgccc       120
     ttgtcgctgt ccatgccgct ttccagcgca aggcacagca gtcgggtcgt cacagcctgg       180
     ctggagggcc tactgcccga caacgcagct gtacgtgagg agtggggtcg ccgcttccaa       240
     gtgtcagcac gcaacccctt cgccctgctg cgccacgtcg ggcgcgacgc tgccggtggc       300
     gtccaggtac tgcccgttga cgttgacccg ccggacgcgg ctctacgcac cggggacgtg       360
     cgccgcctgt ccgaggagca gctctgcagc atgctgcgcg agctcaccgt gcgcgacgcc       420
     ggttgggagg tcggggaggg ctcgggccgg tggagcctag ccggcgcgca gaacaaggtc       480
     gccctgcacc tgctcgacga cggcacctgg ggcgtgccca acgactcgac cccgacaacg       540
     cacatactga aacccacagc ctccggcacc cgctttgggg acttgcaggt aaacgagttc       600
     gtctgtctgc gcgccgctgc ggtgctcggg ctacgcgtcg cccacgtaga gctggtcgac       660
     ttcggcgggg ccaagaccct cgtctcgacc cgatacgacc ggcgtcgcga ccgtaatggg       720
     acgtggctac gccttcacca agaggacctg ctgcaagcaa tgacctaccc accgtccaag       780
     aagtaccagg ccgacaaggg accgagcgtc aagaacgtgg cggcgctgct tgggtcgctg       840
     gggctcgccg atcgctcgcc ggtgcgggaa cgcttcttcg acgccttcgc cttcaacacc       900
     ctggtcggtg gcactgatgc gcacgccaag aactacagcc tgctgctgcg cgggccgcgg       960
     gttgctctgg cgccgctgta cgacgcggct agctacgcgc cgtacctcaa gcctggcgag      1020
     gtcgtgcaca gctcgatgaa ggtcggcaag gcgtggcagg ttcgcgacgt caccgtagag      1080
     gactgggtcg aggtcgcgac cgcgctcgag ctggcccccg actacgcctt ggaccgggtc      1140
     gagcacctgc gtaccggcat ggccggcgca gtcagcgagg ctgcagacca ggcgccggcg      1200
     ccgttcgcga aggccgcacg ccaagtcgcg acggcagtcg ccaagcagag gcacctgcgc      1260
     gtcccgcgat tgccgcgcgc acgccggtga                                       1290
//

If you have problems or comments...

PBIL Back to PBIL home page