(data stored in ACNUC7421 zone)

EMBL: CP002343.PE430

CP002343.PE430       Location/Qualifiers
FT   CDS_pept        483538..483810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0444"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_3839 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46992"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8M3"
FT                   /protein_id="ADU46992.1"
FT                   /translation="MPRRRDPGPSVKDKKLYESLRDEGASKEKAARIANAAAKTSRSAV
FT                   GRKGGSSGDYEDWTKDRLLKRAREIGIEGRSKMDKGELVKALRNH"
     atgccgcgcc gtcgtgatcc gggtccgtca gtcaaggaca agaagctcta cgagtcgctc        60
     cgtgacgagg gggcgagcaa ggagaaggcc gcccgcatcg ccaacgcggc cgccaagacc       120
     tcccgcagcg ccgtcggacg caagggcggc tcgtcgggag actacgagga ctggacgaag       180
     gaccggctgc tgaagcgggc ccgcgagatc ggcatcgagg gccgctcgaa gatggacaag       240
     ggagagctcg tcaaggccct gcggaaccac tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page