(data stored in SCRATCH zone)

EMBL: CP002343.PE433

CP002343.PE433       Location/Qualifiers
FT   CDS_pept        484351..485580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0447"
FT                   /product="natural resistance-associated macrophage protein"
FT                   /note="COGs: COG1914 Mn2+ and Fe2+ transporter of the NRAMP
FT                   family; KEGG: nca:Noca_1876 natural resistance-associated
FT                   macrophage protein; SPTR: Natural resistance-associated
FT                   macrophage protein; PFAM: Natural resistance-associated
FT                   macrophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46995"
FT                   /db_xref="GOA:E6S8M6"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8M6"
FT                   /protein_id="ADU46995.1"
FT                   /translation="MKKLFAIALGILTAIGGFVDIGDLVANGLVGARFGMSLAWVVVVG
FT                   IVGICVFAEMSGRVAAVSGRATFDLIRERLGPRVGLLNLAASMAVTLLTYTAEIGGVAL
FT                   ALELATSVNPYLWIPVVGAAVWLVLWRVRFSLLENAFGLAGLALIVFAVALWQLGPDWS
FT                   ALWESASRPALPEGESRAVYFYYAIALFGAAMTPYEVFFFSSGGVEEGWTEKDLGVMRA
FT                   NVFIGFPLGGLLSLAIAATAAVTFLPQGIQVDSLSQIGLPVGLALGKLGLAFLLLGFFA
FT                   ATFGAACETGLSVGYSISQYFGWQWGKFVEPLRAARFHTVVLLSTIIGVGVLLTTVDPI
FT                   MLTEYSIVFSAVALPLTYFPILVVANDRTYMGNHTNGRLANTLGTIYLFIVGVAAVAAI
FT                   PLMVLTRAGQ"
     gtgaagaagc tcttcgccat cgcgctgggg atcctcacgg ccatcggtgg cttcgtcgac        60
     atcggggacc tcgttgccaa cgggctcgtc ggcgcccgct tcgggatgtc gctcgcgtgg       120
     gtcgtcgtcg tcggcatcgt ggggatctgt gtcttcgccg agatgagcgg gagggtggcg       180
     gccgtcagcg ggcgcgcgac cttcgacctc atccgggagc gcctcgggcc ccgggtcggg       240
     ctgctcaacc tcgctgcctc gatggcggtc acgctgttga cctacacggc ggagatcggt       300
     ggtgtggcgc tcgccctgga gctggcgacc agcgtcaacc cgtacctctg gatccccgtg       360
     gtcggagcgg cggtctggct cgtcctctgg cgggtgcgct tctcgttgct ggagaacgcc       420
     ttcggcctcg ccggcctcgc cctcatcgtc ttcgccgtcg cgctctggca gctcggcccg       480
     gactggtcgg cgctctggga gtcggcgagc cgacccgcgc tgccggaggg cgagagccgg       540
     gccgtctact tctactacgc catcgccctg ttcggggcgg cgatgacccc ctacgaggtg       600
     ttcttcttct cgagcggggg cgtcgaggag ggctggaccg agaaggatct cggcgtcatg       660
     cgggccaacg tcttcatcgg cttcccgctg ggtggcctgc tgtcgctcgc catcgccgcg       720
     accgctgcgg tcaccttcct cccgcagggg atccaggtgg acagcctgag ccagatcggc       780
     ctgcccgtcg ggctcgccct gggcaagctc ggcctggcct tcctgctcct cggcttcttc       840
     gccgccacgt tcggggccgc gtgcgagacc ggcctctccg tcggctacag catctcgcag       900
     tacttcggct ggcagtgggg gaagttcgtc gagccgctcc gcgcagcccg cttccacacc       960
     gtggtgctgc tcagcaccat catcggggtg ggcgtcctcc tcacgaccgt ggacccgatc      1020
     atgctgaccg agtactccat cgtcttcagt gccgtggcgc tgccactcac ctacttcccc      1080
     atcctcgtcg tcgcgaacga ccggacctac atggggaacc acacgaacgg gcggctcgcc      1140
     aacaccctcg gcacgatcta cctgttcatc gtgggcgtgg ccgccgtcgc ggcgatcccg      1200
     ctcatggtcc tgacgagagc ggggcagtga                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page