(data stored in ACNUC7421 zone)

EMBL: CP002343.PE434

CP002343.PE434       Location/Qualifiers
FT   CDS_pept        485582..486397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0448"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amd:AMED_3278 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46996"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8M7"
FT                   /protein_id="ADU46996.1"
FT                   /translation="MADDHLDLVLRVLDHQILGPDRELVGKVDDLELTPTESGLAVTGV
FT                   VVGPGGLSQRLPGRLGDWVAAVWRRLSSSSDPQPVVVPIVHVADLGSGVVLTGRAATAL
FT                   QRSFGLEQWLRQYVVSRIPGAKGGEEDRAPDSDESPSRDEPLVNLTDPPTRPPGPHTRW
FT                   LSQLLGAPVVDESGRHLGSLIELHCGIGNERWTVTHLQVTRSPLGTELGYHADPDQGPV
FT                   VLQRAFRRLQRHDLLIAVGEVREIDTEPPRVVVETRDDRRHPHHDAAAP"
     gtggccgacg accacctgga cctcgtcctt cgcgtgctgg accaccagat cctcggcccg        60
     gaccgggagc tggtcggcaa ggtcgacgac ctggagctca cccccacgga gtcgggactg       120
     gccgtgaccg gtgtcgtcgt cggaccggga gggctcagcc agcggctgcc cgggcggctc       180
     ggtgactggg tcgccgccgt gtggcgacga ctgtcgagca gctcggaccc ccagccggtc       240
     gtcgtgccga tcgtccacgt cgccgacctc gggtcgggcg tcgtgctgac cggccgcgcc       300
     gcgacagcgc tccagcgctc gttcggcctc gagcagtggc tgcgtcagta cgtcgtctcc       360
     cggattcccg gtgccaaggg cggcgaggag gaccgggcac cggactcgga tgagtcacca       420
     agccgggacg agcccctcgt caacctcacc gacccgccga cccgcccgcc cggcccgcac       480
     acccggtggc tcagccagct gctcggagcc ccggtggtgg acgagtcggg ccgccacctc       540
     ggcagcctca tcgagctgca ctgcggcatc ggcaacgagc gctggacggt gacccacctg       600
     caggtcaccc gttctccgct cggcactgag ctgggctacc acgccgaccc cgaccagggc       660
     ccggtggtgc tccagcgggc gttccgccgc ctccagcgcc acgacctgct catcgccgtg       720
     ggcgaggtcc gagagatcga caccgagccg ccgagggtcg tcgtggagac ccgggacgac       780
     cggcgacacc cccaccacga cgcggcggct ccctga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page