(data stored in ACNUC7421 zone)

EMBL: CP002343.PE439

CP002343.PE439       Location/Qualifiers
FT   CDS_pept        complement(492784..496302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0453"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1132 ABC-type multidrug transport system
FT                   ATPase and permease components; InterPro IPR003439:
FT                   IPR017940: IPR003593; KEGG: nca:Noca_2806 ABC transporter
FT                   related; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   SPTR: ABC transporter related; PFAM: ABC transporter
FT                   transmembrane region; ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47001"
FT                   /db_xref="GOA:E6S8N2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8N2"
FT                   /protein_id="ADU47001.1"
FT                   /translation="MTRVEQDEPQATELGARWDARPPTGRVPVDWRRVHRPLTVVCFSM
FT                   SLLGAVSASLGSMVAGRLAEHATSTLVLLLALCVVGGAVIDTVAKVIWAVVCDRAEGRL
FT                   RADLLDAAMAQPLSELSEQAVGEVLDRIDDDTWEVGQLMRWGVWQAVRTLLASGPLWVV
FT                   ASIAWWPAAILFPLTGLATYWVVRRLLPQVAERKVIEEAAWTDHAASTEEGIAARDDLR
FT                   TALGQAHVLRRNARMAARVHAALERVLQVEARITRRSGGLLHGALAAVAVVGAALVLAG
FT                   DLSTARLVTLFLVTTMFVGGVDMLARHLPDLQEGFGAVLRLRAMLASPAEPTGGRPLPE
FT                   GSLGVEFRGLEFSYDTGTFALRDVNLLVPAGHTCALVGRTGSGKSTLASLLSRAVEPPR
FT                   GTVLLGGVDVRDLDLQQLRAAVGVVTQRTEVLAGTLAENMTLFGDVPRARVEAAVAELG
FT                   LTEWVAGLSDGLDTMLGPGGTTLSAGEEQLVAFARLLVRDVRVVVLDEATARMDPVTEA
FT                   RVVRAADRLISGRTGILVAHRLSTTERAEQVAVLESGRVVQQGPRDRLAAAEGPFRRLL
FT                   EAAAHEVAVEEHHHDDASIGSVRRSTTPPPPPELAPSPGLARQVLHTVSIQPQWGLLGA
FT                   GFFLIASLTGAFGAVTGWVWGLVVTDLQSGRQPGWRLGALVVSLVMGPLVLSQAFRTYP
FT                   HWWVEVRLRVRAAVLAGQTAQRRLVRTPPGEVVARTMDADRLARYTDRWVDFVNGLIVA
FT                   SMTALIARTWLAGAVLLVVMVVSALASTLGRPVAGRSAAAASTARASFGRSLVSALESI
FT                   RTVKLAAATPQVHQHLRQVDGGRVDAAVREHRVQALLDGVPIVMVQCGVVAAWAGLLHG
FT                   TWPLAIALLVANAVSGFDWFGRVAGSVVTEAPGVRAWMRATSDLAGGGDLMDLPPGLDL
FT                   VHGTAAEPEPGPRDPLRTLTLHRLTAVHDDGTIGVQDVDLTVEAGELVLLLGQVGSGKS
FT                   SLLSALVGLTAHTGQVLWNGRPVGDAQVELRPARVSHIAQVPRVLSGTFTDNVALDHAR
FT                   RRVEPALATARMERDVAEAGGPDALVGHRGVRLSGGQVQRLALARALACEADLLLADDV
FT                   SSALDAATEIELWAALRSGGATVIGATSKAAALAQADRVVLLDAGRVVEVGPWRELSQR
FT                   WAHLAG"
     atgacgaggg tggagcagga cgagccgcag gcgaccgagc tgggcgctcg gtgggatgcc        60
     cgccctccga cggggcgggt gcccgtggac tggcgccgcg tccaccggcc cctcacggtc       120
     gtctgcttct cgatgtccct gctcggcgcc gtctcggcat ccctggggtc gatggtcgcc       180
     ggccggctgg cggagcacgc cacgtcgacc ctcgtcctgc tcctcgcgct ctgcgtcgtc       240
     ggcggtgccg tcatcgacac cgtcgccaag gtcatctggg cggtggtgtg cgaccgcgcc       300
     gagggccggt tgcgcgccga cctgctcgac gccgcgatgg cccagccgct gtcggagctg       360
     tccgagcagg ccgtgggcga ggtcctcgac cgcatcgacg acgacacctg ggaggtcggc       420
     cagctgatgc gctggggcgt gtggcaggcc gtgcgcaccc tgctcgcctc cggcccgctc       480
     tgggtcgtcg ccagcatcgc ctggtggccg gccgcgatcc tcttccccct gacggggctc       540
     gcgacctact gggtcgtccg gcggctgctc ccccaggtgg ccgagcggaa ggtgatcgag       600
     gaggcggcct ggacggacca cgcggcctcc accgaggaag gcatcgccgc ccgcgacgac       660
     ctgcgcaccg cactgggcca ggcgcacgtg ctgcgccgca acgcacggat ggccgcacgc       720
     gtgcacgcgg ctctcgagcg ggtcctccag gtcgaggccc ggatcacccg gcgcagcggc       780
     gggctgctcc acggcgcgct cgccgccgtc gcggtcgtcg gcgccgccct ggtgctcgcc       840
     ggcgacctct cgaccgcccg gctcgtcacc ctcttcctcg tcacgacgat gttcgtcggc       900
     ggcgtcgaca tgctcgcgcg tcacctgcct gacctgcagg aaggcttcgg cgcggtcctc       960
     cggctgcggg ccatgctcgc gtcgcccgcc gagcccaccg gagggcggcc tctccctgag      1020
     gggtcgctcg gcgtggagtt ccgcgggctc gagttcagct acgacacggg cacgttcgcg      1080
     cttcgcgacg tcaacctcct cgtcccggca gggcacacct gcgcgctcgt cggacgcacc      1140
     ggctccggca agtccacgct cgcgtcactg ctgtcccgcg ccgtcgagcc gccgcgtggg      1200
     acggtgctgc tgggcggggt cgacgtgcgg gacctcgacc tgcagcagct gcgcgcagcg      1260
     gtcggcgtcg tcacccagcg caccgaggtg ctcgccggca ccctcgccga gaacatgacg      1320
     ctcttcggcg acgtgccccg ggccagggtc gaggccgccg tcgccgagct cggtctcacc      1380
     gagtgggtcg ccgggctctc cgacggcctc gacacgatgc tcggccccgg cggcaccacg      1440
     ctctcggccg gcgaggagca gctcgtcgcc ttcgcccggc tgctcgtccg ggacgtgcgg      1500
     gtcgtcgtcc tcgacgaggc caccgcccgg atggacccgg tgaccgaggc gcgggtggtc      1560
     cgggccgcgg accggctcat ctcggggcgc accggcatcc tcgtcgccca ccgcctgtcg      1620
     acgacggagc gcgccgagca ggtcgcggtc ctcgagtcgg gtcgggtggt ccagcagggc      1680
     ccccgcgacc ggctggccgc cgccgagggg ccgttccgcc ggctcctcga ggcggccgcc      1740
     cacgaggtcg ccgtggagga gcaccaccac gacgacgcct ccatcggctc ggtccgccgg      1800
     agcaccaccc cgccaccgcc cccggagctg gctccgagcc cgggcctggc caggcaggtc      1860
     cttcacacgg tgagcatcca gccgcagtgg ggcctgctcg gcgctgggtt cttcctcatc      1920
     gcctcgctga ccggggcgtt cggcgcggtg accggctggg tctggggtct cgtcgtcacc      1980
     gacctgcagt ccggacgtca gccgggttgg cggctcggtg cgctcgtcgt ctcgctcgtg      2040
     atgggcccgc tcgtcctgtc gcaggcgttc cgcacctatc cgcactggtg ggtggaggtc      2100
     cggctccggg tgcgcgccgc ggtgctcgcc ggccagacgg cgcagcgccg gctcgtccgg      2160
     accccgcccg gtgaggtggt cgcccgcacc atggacgcgg accgcctcgc gcgctacacc      2220
     gaccgctggg tcgacttcgt caacgggctg atcgtcgcct cgatgacggc cctcatcgcc      2280
     cgcacgtggc tggccggcgc ggtcctgctc gtggtcatgg tcgtctccgc gctggcctcg      2340
     accctgggcc gaccggtcgc cggacgctcc gccgcggccg cctcgacggc ccgggccagc      2400
     ttcggtcggt cgctggtctc ggccctcgag tcgatccgca ccgtcaagct cgccgccgcg      2460
     accccgcagg tgcaccagca cctgcgccag gtggacggcg gccgggtcga tgcggccgtc      2520
     cgcgagcacc gggtccaggc gctgctcgac ggagtgccga tcgtcatggt ccagtgcggt      2580
     gtcgtggcag cgtgggcggg cctgctccac ggcacgtggc cgctggcgat cgcgctgctc      2640
     gtcgcgaacg ccgtcagcgg cttcgactgg ttcggccggg tcgccgggtc ggtcgtcacc      2700
     gaggcacccg gcgtgcgcgc ctggatgcgg gccacgagcg acctggccgg cggcggcgac      2760
     ctgatggacc tgcccccggg cctcgacctg gtgcacggca ccgctgccga gcccgagccc      2820
     ggcccgcgcg atccactgcg caccctcacc ctgcaccggc tgaccgcggt ccacgacgac      2880
     ggcaccatcg gcgtccagga cgtcgacctc acggtcgagg cgggcgagct cgtgctcctg      2940
     ctgggccagg tcggctcggg caagtccagc ctgctctccg ccctggtggg tctgacggcc      3000
     cacaccggcc aggtcctctg gaacggccgg cccgtgggcg acgcgcaggt ggagctgcga      3060
     cccgcccggg tctcacacat cgcccaggtg ccccgggtgc tgtccgggac gttcacggac      3120
     aacgtggccc tcgaccatgc ccgccgccgc gtcgagccgg ccctcgcgac cgcccggatg      3180
     gagcgcgacg tcgccgaggc gggcgggccc gacgcgctcg tcggccaccg aggggtccgg      3240
     ctctccggcg gccaggtcca acgcctggcc ctcgcgcgcg ccctcgcctg cgaagccgac      3300
     ctgctgctgg ccgacgacgt gtcctcagcg ctcgacgcgg ccaccgagat cgagctctgg      3360
     gcggcactcc ggtccggcgg tgcgacggtg atcggcgcga cgagcaaggc ggccgccctg      3420
     gcccaggccg accgagtcgt cctcctcgac gcgggccggg tcgtcgaggt cggtccctgg      3480
     cgcgagctct cgcagaggtg ggcccacctc gccgggtaa                             3519
//

If you have problems or comments...

PBIL Back to PBIL home page