(data stored in ACNUC7421 zone)

EMBL: CP002343.PE44

CP002343.PE44        Location/Qualifiers
FT   CDS_pept        complement(48644..50131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0044"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COGs: COG0515 Serine/threonine protein kinase;
FT                   InterPro IPR017442: IPR002290: IPR000719; KEGG:
FT                   kra:Krad_3232 protein kinase; PFAM:
FT                   Serine/threonine-protein kinase-like domain; SMART:
FT                   serine/threonine protein kinase; SPTR: Probable
FT                   serine/threonine-protein kinase; PFAM: Protein kinase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46606"
FT                   /db_xref="GOA:E6SEK5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEK5"
FT                   /protein_id="ADU46606.1"
FT                   /translation="MEDHPRPGEFVTVRPGAAGAPWVADPLGEPSPPPLDGAPTLEDVV
FT                   QQTGGLTDGETIAVAGRVATALAAAHGAGVVHGALDPGVVVLSPEDGVVQVGGFGGSAG
FT                   SAGSAGSAGSAGGGSGSTAEDAPSPYLAPEQVAGDEADARSDLYALGCLMMTLLSGAPP
FT                   APATLVATGPDSSEPAAARTGAPWPSDAKPDVDPALNGLVHDLLAVSPDRRPTSAGEVV
FT                   SRLGRIEADLADRGVVVALPVAVGVGVAAAAADLPDDSEPTLMDSLIGEESGDESEDES
FT                   DDGSPSAAGSLATRPMAMVTTLPWPWVSGSLAAVALVLVILFMSFGRGGVDAPTGAPGT
FT                   IAPAPTSPTATEPATSNGTTTAGTSTTSRTTTTNLTSTTTTTSLTSAASPPAPSRTASP
FT                   PVASTAPRSLDEAISSLRSTVRSVVANGDVGAAAGQDLIAAADELTTWADRSSVQLRRR
FT                   VSDLDGYVDRLLSSGDITNAGYQQVSGAISAVQGQLG"
     atggaggacc acccgcgacc gggggagttc gtcacggttc gtcccggcgc agcgggggcc        60
     ccgtgggtcg ccgatcccct cggtgagccc agcccgccac ccctggacgg cgcacccacg       120
     ctcgaggacg tggttcagca gactgggggc ctgacggacg gcgagacgat cgcggtggcc       180
     ggtcgggtgg ccactgcgct cgccgcagcg cacggcgccg gcgtcgtgca cggcgcgctc       240
     gacccggggg tcgtcgtgct ctcgccggag gacggggtcg tgcaggtcgg cggcttcggg       300
     ggatcagcgg ggtcagcggg gtcagcgggg tcagcggggt cagcgggggg cggcagtgga       360
     tcgaccgccg aagacgcgcc ctctccctat ctcgcgcccg agcaggtcgc cggggacgag       420
     gccgacgcac gcagcgacct ctacgccctc ggctgcctca tgatgaccct gctgagcgga       480
     gcacctccag cacccgcgac gctcgtcgcg acgggaccgg acagctctga gccagcagcc       540
     gcgcggaccg gcgcaccgtg gccgtccgac gcgaagcccg atgtcgatcc agccctgaac       600
     gggctcgtcc acgacctgct cgctgtgtcg ccggaccgtc gcccgacgtc cgcgggtgag       660
     gtcgtgagcc ggttggggcg gatcgaggcc gacctggccg accggggcgt cgtcgtggcc       720
     ctgccggtcg ccgtcggggt cggggtcgcc gctgccgccg ctgatctccc cgacgactcg       780
     gaaccgaccc tgatggactc gctgatcggc gaggagtcgg gggacgagtc ggaagacgag       840
     tcggatgacg gctccccttc ggctgcgggg tcactcgcga cgcggccgat ggcgatggtc       900
     accaccctcc cgtggccgtg ggtcagcggg agcctggccg cggtcgcact cgtcctcgtc       960
     atcctcttca tgtcgttcgg tcgtggcggc gtcgacgccc cgactggcgc acccgggacg      1020
     atcgcgccgg cgccaaccag ccccacagcg accgagcctg ccacctcgaa cggcacgacc      1080
     accgccggga cgtcgacgac gagccgtacg accacgacga acctgaccag cacgacgact      1140
     accaccagcc tcacctcggc ggcgagcccg cctgcaccaa gccggacagc ctcgcctccc      1200
     gtggcaagca cggcgccgcg gagtctcgac gaggcgatca gctcactccg atccacggtg      1260
     cgcagcgtcg tcgcgaacgg agacgtcggc gccgcagccg gccaggacct catcgcagct      1320
     gccgacgagc tcacgacgtg ggcagaccgc agctccgtcc agctgagacg cagggtgtcg      1380
     gacctcgacg gctacgtcga ccggctgctc tcgtcgggag acatcaccaa cgcgggttac      1440
     caacaggtgt ccggcgccat ctctgcagtg caagggcagc tcggctga                   1488
//

If you have problems or comments...

PBIL Back to PBIL home page