(data stored in SCRATCH zone)

EMBL: CP002343.PE440

CP002343.PE440       Location/Qualifiers
FT   CDS_pept        complement(496435..498120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0454"
FT                   /product="alpha amylase catalytic region"
FT                   /note="COGs: COG0366 Glycosidase; InterPro IPR006047:
FT                   IPR006589; KEGG: mgi:Mflv_3723 alpha amylase, catalytic
FT                   region; PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; SPTR: Alpha amylase,
FT                   catalytic region; PFAM: Alpha amylase, catalytic domain;
FT                   TIGRFAM: trehalose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47002"
FT                   /db_xref="GOA:E6S8N3"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8N3"
FT                   /protein_id="ADU47002.1"
FT                   /translation="MRMSQTGDLWWKTAVLYCADVQTFYDSDSDGVGDLRGMTEQIEYL
FT                   ADLGITCLWLMPIYPTPSKDDGYDITDFYGVERRLGTHGDFVELVRTARAHGIRVILDF
FT                   VMNHTSDQHPWFRSARRSTDDPYRDYFVWSPTKPKTNPKDIVFPDQEDSLWELEPKTGE
FT                   YYLHHFYKHQPDLNVVNPAVQEEIARTIGFWLELGVSGFRVDAVPFLMTPDTVPADHHQ
FT                   VSFDPKRYLADVRKYVTRRVGDALLLGEVNLPYKDQKTYFGGADGDGLNMQFDFAAMQA
FT                   LYLALAREDARPIEGALRRRPALDVTSQWANFVRNHDELTLDQLTDEERQDVFDAFGPD
FT                   PGMQLFGRGLRRRLPSMLGGDGRRLRLVYSIMFSLPGTPVLFYGEEIGMAENLDVPGRL
FT                   SVRTPMQWGDDPSGGFSDAPPRKLTRPMPDGLYSAERVNVASQRHDHDSLWWFIRTLIR
FT                   LRRQYPQIGWSTVEVPRTKPRSVLAHLAREEDGWTMLALHNLAPESTLVDVSLGEVPPG
FT                   SVLVDLLGDRREHPVAADGSIELEVEGYGYRWLLLHRPGDRPPK"
     atgagaatga gccagaccgg tgacctgtgg tggaagacgg ccgtcctcta ctgcgccgac        60
     gtccagacct tctacgactc cgacagcgac ggcgtcggcg acctcagggg gatgacggag       120
     cagatcgagt acctcgccga cctcggcatc acctgcctgt ggctcatgcc gatctacccc       180
     accccgtcga aggacgacgg ctacgacatc accgacttct acggggtcga acgccgcctc       240
     gggacgcacg gtgacttcgt cgagctcgtg cggaccgcgc gagcccacgg catccgcgtc       300
     atcctcgact tcgtcatgaa ccacacgtcc gaccagcacc cgtggttcag gtcggcgcgg       360
     cgcagcacgg acgaccccta ccgggactac ttcgtgtgga gcccgacgaa gccgaagacg       420
     aacccgaagg acatcgtctt ccccgaccag gaggacagcc tctgggagct ggagccgaag       480
     accggggagt actacctgca ccacttctac aagcaccagc cggacctcaa cgtggtcaac       540
     ccggcggtgc aggaggagat cgcccggacg atcggcttct ggctcgagct cggggtgtcc       600
     gggttccggg tggacgccgt gccgttcctc atgacgccgg acacggtgcc ggccgaccac       660
     caccaggtct ccttcgaccc gaagcgctac ctcgcggacg tccgcaagta cgtgacccga       720
     cgggtcggcg acgcgctgct cctcggggag gtcaacctgc cctacaagga ccagaagacg       780
     tacttcggcg gtgcggacgg cgacgggctc aacatgcagt tcgacttcgc ggcgatgcag       840
     gccctctacc tggctctcgc ccgcgaggac gcgcgcccga tcgagggagc cctgcgccgg       900
     cgcccggccc tcgacgtgac cagccagtgg gccaacttcg tccgcaacca cgacgagctg       960
     actctcgacc agctgacgga cgaggagcga caggacgtct tcgacgcgtt cggacccgat      1020
     ccggggatgc agctcttcgg ccggggcctg cgccgacggc tgccgtcgat gctcggcggt      1080
     gacggccgac gcctccgcct cgtctactcg atcatgttct ccctgcccgg gacaccggtg      1140
     ctcttctacg gcgaggagat cggcatggcc gagaacctcg acgtgcccgg tcgtctctcg      1200
     gtccggacgc cgatgcagtg gggcgacgac ccgagcgggg gcttcagcga cgccccgccc      1260
     cgcaagctga cccggccgat gcccgacggg ctctactcgg ccgagcgggt caacgtcgcg      1320
     agccagcgcc acgaccacga ctccctgtgg tggttcatcc gcaccctgat ccggctccgg      1380
     cggcagtacc cccagatcgg ctggtcgacc gtggaggtgc ctcgcaccaa gccccggagc      1440
     gtcctcgcac acctggcccg ggaggaggac ggctggacca tgctggcgct gcacaacctc      1500
     gccccggaga gcactctcgt cgacgtctcg ctcggcgagg tgccacccgg ctccgtgctc      1560
     gtcgacctgc tgggcgaccg ccgcgagcac cccgtcgccg cggacgggag catcgagctc      1620
     gaggtcgagg gctacggcta ccggtggctc ctgctgcacc gtccgggcga ccgcccgccg      1680
     aagtga                                                                 1686
//

If you have problems or comments...

PBIL Back to PBIL home page