(data stored in SCRATCH zone)

EMBL: CP002343.PE441

CP002343.PE441       Location/Qualifiers
FT   CDS_pept        498267..499253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0455"
FT                   /product="F420-dependent oxidoreductase, G6PDH family"
FT                   /note="COGs: COG2141 Coenzyme F420-dependent N5
FT                   N10-methylene tetrahydromethanopterin reductase; InterPro
FT                   IPR019945; KEGG: mgi:Mflv_3722 putative dehydrogenase
FT                   protein; SPTR: Putative dehydrogenase protein; TIGRFAM:
FT                   F420-dependent oxidoreductase, G6PDH family; PFAM:
FT                   Luciferase-like monooxygenase; TIGRFAM: F420-dependent
FT                   oxidoreductase, G6PDH family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47003"
FT                   /db_xref="GOA:E6S8N4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR023907"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8N4"
FT                   /protein_id="ADU47003.1"
FT                   /translation="MPTIGFHCSHEQIPPSQLLEDVRHAEAAGFTAAMCSDHLEPWSTD
FT                   QGQSGYAWSWLGAALNATRLPFGVVTAPGQRYHPAITAQAIGTLGEMFPGRFWAALGSG
FT                   EAVNEHVTGDGWPRKELRDQRLVECAEVIRRLLDGERVSHDGLVTVDRAKVWSRPSTPP
FT                   DLVAAAVSVETAGSAAAWADGLITVNQQEGGDRRAAEAYREHGGRGPARLQLHVSWAPS
FT                   EDEALDIAMQQWRSNVFGSPVAWDTDSVDAFDELGRHVTEDDVRRSVHVSADLESHAAR
FT                   IGQAFDDGFDAVMVHFVGTDQAPFIDAFAAAVLPQFTPAALTGRSTS"
     atgcccacga tcggcttcca ctgctcgcac gaacagattc ccccctccca gctcctcgag        60
     gacgtcaggc acgcagaggc ggccgggttc acggcagcga tgtgctcgga ccacctcgag       120
     ccgtggagca cggaccaggg ccagtccggc tatgcctggt cgtggctcgg cgctgcgctc       180
     aacgcgacgc gcctgccctt cggcgtcgtc acggcgccgg gccagcggta ccaccccgcc       240
     atcacggcgc aggccatcgg caccctggga gagatgttcc ccgggcggtt ctgggctgcc       300
     ctcggctcgg gggaggcggt gaacgagcac gtgaccggtg acggctggcc gcgcaaggag       360
     ctccgggacc agcggctcgt cgagtgcgcc gaggtgatcc ggcgcctgct cgacggcgag       420
     cgggtgtccc acgacgggct cgtgacggtc gaccgggcca aggtctggtc ccgcccgagc       480
     acgcccccgg acctcgtcgc cgcggcggtc agcgtcgaga cggccggcag cgccgcggcc       540
     tgggccgacg ggctcatcac ggtgaaccag caggagggcg gggaccggcg ggccgccgag       600
     gcctaccggg agcacggcgg gcgggggccg gcccggctcc agctccacgt cagctgggcg       660
     ccttccgagg acgaggcgct cgacatcgcg atgcagcagt ggcgcagcaa cgtcttcggc       720
     tcgcccgtcg cgtgggacac cgactccgtc gacgccttcg acgagctggg gcggcacgtc       780
     accgaggacg acgtccgccg ttccgtgcac gtatcagccg atctcgagtc gcatgcggcc       840
     cggatcgggc aggcgttcga cgacggcttc gacgcggtca tggtgcactt cgtcggcacc       900
     gaccaggcgc ccttcatcga cgcattcgca gcagcggtcc tccctcagtt cacccccgct       960
     gccctcactg gaaggagcac atcgtga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page