(data stored in ACNUC7421 zone)

EMBL: CP002343.PE443

CP002343.PE443       Location/Qualifiers
FT   CDS_pept        500312..501436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0457"
FT                   /product="glutamate--cysteine ligase GCS2"
FT                   /note="COGs: COG2170 conserved hypothetical protein;
FT                   InterPro IPR006336: IPR011793; KEGG: sgr:SGR_459
FT                   carboxylate-amine ligase; PFAM: glutamate--cysteine ligase
FT                   GCS2; SPTR: Carboxylate-amine ligase SACT1DRAFT_0179; PFAM:
FT                   Glutamate-cysteine ligase family 2(GCS2); TIGRFAM:
FT                   uncharacterized enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47005"
FT                   /db_xref="GOA:E6S8N6"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8N6"
FT                   /protein_id="ADU47005.1"
FT                   /translation="MVRTVGVEEEMLLVDVRNGRPKSVSGQLVLRAAMQQQAVAGLGVH
FT                   GALEGEFQQQMIETHTAPVESLEDLEREVRHWRTEANSAARQVGSSVAALATSPLPVTP
FT                   IPVESTRYAWMHDRYQIVAKQHLTCGLHVHVAIGSDEEGVGVLDRIRVWLPVLLALSGN
FT                   SPFWNGEATGFASWRSQSFGRWPSNGPTEIFGSAAAYHRMVRDMTMSSVILDEGMVYFD
FT                   ARLSQHYPTVEIRVADVCLRASDAVLLAALCRGLVETAARDWARSVPVPDVPTTMVRLA
FT                   TWQAAREGTEGRLLDPFTSRPRLAWDVVDRLVEYVAPALSEAGDVELVKEGLERIRTRG
FT                   NGAQLQTRTMERTGQLIDVVAHAVRVTAGQEEDD"
     atggtcagaa cggtcggtgt cgaggaggag atgctcctcg tcgacgtgcg caacggtcgg        60
     cccaagtcgg tgtccggaca gctcgtcctg cgtgccgcca tgcagcagca ggccgtcgcc       120
     ggcctcgggg tccatggcgc cctcgagggc gagttccagc agcagatgat cgagacgcac       180
     accgcccccg tcgagtccct cgaggacctc gagcgcgaag tccggcactg gcggaccgag       240
     gcgaactccg ctgcccggca ggtcggttcg agcgtcgcag cgctcgcgac ctcaccgctg       300
     ccggtgactc cgatcccggt cgagtcgacc cgctacgcgt ggatgcacga tcgctaccag       360
     atcgtcgcca agcagcatct cacctgcggg ctgcacgtcc atgtcgccat cgggtccgac       420
     gaggagggcg tcggtgtcct cgaccggatc cgcgtgtggc tgcccgtgct cctcgcgctc       480
     agcgggaact cgccgttctg gaacggcgag gcgaccgggt tcgcgagctg gcgctcgcag       540
     tcgttcggcc ggtggccctc gaacggtccc accgagatct tcggctccgc cgcggcctac       600
     caccggatgg tgcgcgacat gacgatgtcc tcggtcatcc tcgacgaggg catggtctac       660
     ttcgacgccc gcctgagcca gcactacccg accgtcgaga tccgggtggc cgacgtgtgc       720
     ctccgggcca gtgacgccgt cctcctcgcg gcgctctgcc ggggcctcgt cgagacggcg       780
     gcgcgcgact gggcccgttc ggtcccggtc cccgacgtgc ccacgacgat ggtgcgcctc       840
     gccacctggc aggccgcgcg ggaggggacc gagggacgtc tgctcgaccc gttcacctcc       900
     cggccgcggc tcgcgtggga cgtcgtcgac cggctggtcg agtacgtcgc acccgccctg       960
     tccgaggcgg gggacgtcga gctggtcaag gagggtctcg agcggatccg cacccgtggc      1020
     aacggtgccc agctgcagac ccgcaccatg gagcggaccg gccagctcat cgacgtcgtc      1080
     gcgcacgcgg tccgggtcac cgccggccag gaggaggacg actga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page