(data stored in ACNUC7421 zone)

EMBL: CP002343.PE446

CP002343.PE446       Location/Qualifiers
FT   CDS_pept        502378..503226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0460"
FT                   /product="RNA polymerase, sigma 28 subunit, Sig B/F/G
FT                   subfamily"
FT                   /note="COGs: COG1191 DNA-directed RNA polymerase
FT                   specialized sigma subunit; InterProIPR007627: IPR007624:
FT                   IPR007630: IPR000943: IPR 014322: IPR014284; KEGG:
FT                   nca:Noca_1393 sigma-70 region 4 domain-containing protein;
FT                   PFAM: sigma-70 region 2 domain protein; sigma-70 region 3
FT                   domain protein; sigma-70 region 4 domain protein; SPTR:
FT                   Sigma-70 region 4 domain protein; TIGRFAM: RNA polymerase
FT                   sigma-70 factor, sigma-B/F/G subfamily; RNA polymerase
FT                   sigma factor, sigma-70 family; PFAM: Sigma-70, region 4;
FT                   Sigma-70 region 3; Sigma-70 region 2; TIGRFAM: RNA
FT                   polymerase sigma factor, sigma-70 family; RNA polymerase
FT                   sigma-70 factor, sigma-B/F/G subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47008"
FT                   /db_xref="GOA:E6S8N9"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8N9"
FT                   /protein_id="ADU47008.1"
FT                   /translation="MSRMKSVSPTSTPTPISRRRGRFVERDRKAEELLLELSRTTNCAE
FT                   RERLTDEIVRLHLDLCDGVAARYAGRSIPTEDLVQVARLALLVAIKRYQPGPGSSFIGY
FT                   ALPTISGELKRHFRDHGWMVRPPRRLQELGPVLRLAREHWEQEHGTSPTTQDLAEEVGV
FT                   DPEQVSECLSAEHSYHPLSLDLTFGDDESRSLAESLAEPQDELESAADRVSLGTALSSL
FT                   SQKDRELLQMRFVDGMTQKEIGLALGVSQMQVSRLVRAVLDRLRTQMGVTVDDDRSATA
FT                   A"
     atgtcacgca tgaagtccgt ttcccccacc agcacgccca ccccgatcag ccgccgtcgc        60
     ggccgattcg tcgagaggga ccggaaggcg gaggagctgc tcctcgagct ctcgcgtaca       120
     acgaactgcg cggagcgcga aaggctcacc gacgagatcg tccggctcca cctcgacctc       180
     tgtgatggcg tggctgcccg ctacgccggg cgcagcatcc cgaccgagga cctcgtccag       240
     gtcgcgcggc tcgcgctcct cgtcgcgatc aagcggtacc agccgggccc cggctcgtcg       300
     ttcatcggct acgccctccc gaccatctcg ggcgagctga agcggcactt ccgggaccac       360
     gggtggatgg tccgcccgcc ccggcggctc caggagctcg gccctgtcct ccgcctcgcc       420
     cgcgagcact gggagcagga gcacggcacc tcgccgacca cgcaggacct cgccgaggag       480
     gtcggcgtcg acccggagca ggtctccgag tgcctgtccg cggagcacag ctaccacccg       540
     ctgtcgctcg acctcacctt cggagacgac gagtcccgct cccttgcgga gagcctcgcc       600
     gagccgcagg acgagctcga gtcggcggcg gaccgggtct cgctcgggac cgcgctgagc       660
     agcctgtcgc agaaggaccg tgagctgctc cagatgcggt tcgtcgacgg gatgacgcag       720
     aaggagatcg gcctcgcgct cggcgtcagc cagatgcagg tctctcgcct cgtccgggcc       780
     gtcctcgaca ggctgcgcac ccagatgggc gtcacggtcg acgacgaccg cagcgccacc       840
     gccgcctga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page