(data stored in ACNUC7421 zone)

EMBL: CP002343.PE447

CP002343.PE447       Location/Qualifiers
FT   CDS_pept        503472..504518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0461"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="COGs: COG2207 AraC-type DNA-binding
FT                   domain-containing protein; InterPro IPR018060: IPR000005;
FT                   KEGG: mkm:Mkms_4430 AraC family transcriptional regulator;
FT                   PFAM: helix-turn-helix- domain containing protein AraC
FT                   type; SMART: Helix-turn-helix, AraC domain; SPTR: AraC
FT                   family transcriptional regulator; PFAM: Bacterial
FT                   regulatory helix-turn-helix proteins, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47009"
FT                   /db_xref="GOA:E6S8P0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8P0"
FT                   /protein_id="ADU47009.1"
FT                   /translation="MSLSTSTTSSIHHVTLTATDPTAIERICAEELGVPLRLVGCPDGP
FT                   YVALAHTDAGRFSIDVLSGAGLSAELRPRDDAGPTGTDSTGSSESALFLTGERGQIRLD
FT                   AAGSVEQVGPGQSVCLARAAETSRVDWTGDAPRAHCVRLDLALIRDIAAATTGVTDVVF
FT                   TGSRPVSRAAELHWQETVTHVARTLSGVPGVPVTPLVVGEAARFLAAVALATFPNTTME
FT                   SVRRDTDAAPQPVTDLPITAETVRDAIAFIEERAHDDLTVADVAAAAGVTARAVQLAFR
FT                   RHLDTTPMAYLRRVRLARVHDELAHAEPDAGVTVTEVASKWGFSGSSRFTAYYRDAFGE
FT                   VPSQTLAS"
     atgtccctat cgaccagcac caccagcagc atccaccacg tcaccctcac ggcgacggac        60
     ccgactgcga tcgagcggat ctgcgcggag gagctcggcg ttccgcttcg cctcgtcggc       120
     tgcccggacg ggccctatgt ggcgctggcc cacaccgacg cagggcggtt ctccatcgac       180
     gtcctgtccg gcgcgggcct ctcggcagag ctccgtccgc gcgatgacgc cggcccgacc       240
     gggaccgact cgaccggctc gtccgagtcg gcgctcttcc tgaccggcga gcggggccag       300
     atccgcctcg acgcggccgg cagcgtcgag caggtcggcc ccggccagtc cgtgtgcctg       360
     gcccgcgcgg ccgagaccag tcgagttgac tggaccggcg acgcgccacg tgcccactgc       420
     gtccgactcg acctggcgct gatccgcgac atcgcggcgg ccaccaccgg cgtgaccgac       480
     gtggtcttca ccgggagccg gcccgtgagc cgggccgccg agctgcactg gcaggagacg       540
     gtcacccacg tggcccgcac cctgtccggc gtccccggcg tgccggtcac gccgctcgtc       600
     gtcggcgagg cggcccggtt cctcgccgca gtcgcgctcg cgaccttccc gaacacgacg       660
     atggagtcgg tgcggcgcga caccgacgcc gccccgcaac ccgtgaccga cctgccgatc       720
     acggccgaga cggtgcgcga cgcgatcgcc ttcatcgagg agcgcgctca cgacgacctc       780
     accgtcgccg acgtcgctgc cgcggcggga gtcacggcaa gggccgtcca gctcgccttc       840
     cgccgccacc tcgacacgac gccgatggcc tacctgcgca gggtccggct ggcgcgggtg       900
     cacgacgagc tcgcgcacgc cgagcccgac gccggcgtga ccgtcaccga ggtcgcctcg       960
     aagtggggct tcagcgggtc gagccggttc acggcgtact accgggacgc cttcggcgag      1020
     gtccccagcc agacgctcgc cagctga                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page