(data stored in ACNUC7421 zone)

EMBL: CP002343.PE448

CP002343.PE448       Location/Qualifiers
FT   CDS_pept        504793..505080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0462"
FT                   /product="Domain of unknown function DUF1905"
FT                   /note="InterPro IPR015018; KEGG: bcv:Bcav_4116 hypothetical
FT                   protein; PFAM: Domain of unknown function DUF1905; SPTR:
FT                   Putative uncharacterized protein; PFAM: Domain of unknown
FT                   function (DUF1905)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47010"
FT                   /db_xref="InterPro:IPR015018"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8P1"
FT                   /protein_id="ADU47010.1"
FT                   /translation="MDLEFSGEIVWWRGPAPYHFVRVPDGESAQIEAVKHLVTYGWGVI
FT                   PVTAVVGDTEFTTSLFPKDGAFLVPLKDGVRQAESLELGEVVSIRLILDV"
     atggacctgg agttcagcgg cgagatcgtc tggtggcgag ggcccgcgcc gtaccacttc        60
     gtccgcgttc cggacgggga gtcggcccag atcgaggccg tcaagcacct cgtcacctac       120
     ggctgggggg tcatcccggt gacggcggtc gtgggcgaca ccgagttcac cacgtcgctc       180
     ttccccaagg acggagcctt cctcgtcccg ctcaaggacg gcgtccgtca ggccgagtcc       240
     ctcgagctgg gcgaggtcgt ctcgattcgg ctcatcctcg atgtctga                    288
//

If you have problems or comments...

PBIL Back to PBIL home page