(data stored in SCRATCH zone)

EMBL: CP002343.PE449

CP002343.PE449       Location/Qualifiers
FT   CDS_pept        complement(505174..506286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0463"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="COGs: COG0628 permease; InterPro IPR002549; KEGG:
FT                   cmi:CMM_0741 hypothetical protein; PFAM: protein of unknown
FT                   function UPF0118; SPTR: Putative integral membrane protein;
FT                   PFAM: Domain of unknown function DUF20"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47011"
FT                   /db_xref="GOA:E6S8P2"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8P2"
FT                   /protein_id="ADU47011.1"
FT                   /translation="MNPPQPPAAASGPWQDRLGRAAIRSLQVLAVLTLLVIVVWVGVQL
FT                   RLVVVPLLIAVLIAAAASPLVTWLNRRGLPRAPSVWVTLLAAFAVLGGLGWLVARAAQD
FT                   QWGELAAGAGEGVKELERFLAESPLGLDRREIEDLWAQAAEFLAGPQGQGVITGATLVV
FT                   EILAGIFLGLVLLYFLLKDGDRIWTFLRSELLPDRHSPRFDRVAAEAVSTLGGYVRGTA
FT                   LIALVEATLIGAAVAILGVPLALPIAIVVFIGAFIPLLGATAAGALAALIALVSNGVVA
FT                   ALVLVAVVIVVNQLEGDVLSPYVLGKAVSLHPLAVLLALSAGTISAGIIGAILAVPFAA
FT                   VAWSAITTWRSTEEPGRGSPQPPPPATPPQ"
     atgaacccac cgcagccgcc tgcggcagcg agcggaccct ggcaggaccg gctgggacga        60
     gccgccatcc gcagcctcca ggtcctcgcc gtgctcacgc tcctcgtcat cgtcgtgtgg       120
     gtgggggtcc agctgcgcct cgtcgtcgtg cccctgctca tcgccgtcct catcgccgcc       180
     gcggcgagcc cgctcgtcac ctggctgaac cgccgtggcc tgccgcgcgc gccctcggtg       240
     tgggtcacgc tgctcgccgc gttcgcggtc ctcggcgggc tggggtggct cgttgcgcgc       300
     gccgcccagg accagtgggg tgagctcgcg gcgggcgccg gcgaaggggt caaggagctc       360
     gagcggttcc tcgcggagtc accgctcggg ctcgaccgaa gggagatcga ggacctgtgg       420
     gcgcaggccg cggagttcct ggccgggccc cagggccagg gcgtcatcac cggagccacc       480
     ctggtcgtcg agatcctcgc gggcatcttc ctcgggctcg tcctgctcta cttcctcctc       540
     aaggacgggg accgcatctg gaccttcctg cgcagcgagc tgctgcccga ccggcactcg       600
     ccacgcttcg accgggtcgc cgcggaggcc gtgtccacct tgggcggcta cgtccgaggc       660
     accgccctca tcgcgctcgt cgaggcgacg ttgatcggcg ccgccgtggc gatcctcggc       720
     gtgccgttgg ccctcccgat cgccatcgtc gtcttcatcg gcgcgttcat cccgctcctc       780
     ggcgcgacgg ccgccggcgc gctcgcggcg ctcatcgcgc tggtcagcaa cggtgtcgtc       840
     gctgccctcg tcctcgtggc ggtggtcatc gtcgtcaacc agctggaggg cgacgtcctg       900
     tccccctacg tcttgggcaa ggccgtgtcg ctgcaccccc tcgccgtgct gctcgccctc       960
     tcggccggga cgatctccgc gggcatcatc ggggccatcc tcgccgtgcc gttcgcggcc      1020
     gtcgcctggt cggcgatcac gacctggcgc agcaccgagg agcccgggcg cggttccccg      1080
     cagcccccac cgcccgcaac gcccccacag tga                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page