(data stored in ACNUC7421 zone)

EMBL: CP002343.PE451

CP002343.PE451       Location/Qualifiers
FT   CDS_pept        complement(508128..508532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0465"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_2801 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47013"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8P4"
FT                   /protein_id="ADU47013.1"
FT                   /translation="MHCAARGGHAPGRARRGRSLRPKPAKRSQLLGLASPNPSHVMLVP
FT                   RGRRWLERPRARILGAMATSSAHPRPRPASSPFKPHVEPEVEDFTVGDRVSHDSYGVGR
FT                   VVGIDASGATVDFSGRTIRVTTPFRKMTKL"
     atgcactgcg ccgcccgcgg cggtcacgct cctggccgag cgcgtcgagg gcggagcctc        60
     cggcccaagc cggccaagcg gtcccagctc ctggggttgg cctcgcccaa cccgagccat       120
     gtgatgctcg tcccccgtgg gcggcggtgg ctcgagcggc ctcgtgcgcg catactgggg       180
     gcaatggcaa cctcatctgc acacccgcgt ccgcgtcccg ccagcagtcc cttcaagccg       240
     cacgtcgagc cggaagtcga ggacttcacg gtgggcgacc gggtctcaca cgactcctac       300
     ggggtgggtc gagtcgtggg gatcgacgcc agcggcgcca ccgtggactt cagtggccgg       360
     acgatccggg tcaccacccc cttccgcaag atgaccaagc tctag                       405
//

If you have problems or comments...

PBIL Back to PBIL home page