(data stored in ACNUC7421 zone)

EMBL: CP002343.PE453

CP002343.PE453       Location/Qualifiers
FT   CDS_pept        510091..510546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0468"
FT                   /product="GatB/YqeY domain protein"
FT                   /note="COGs: COG1610 conserved hypothetical protein;
FT                   InterPro IPR019004; KEGG: ami:Amir_0234 GatB/YqeY domain
FT                   protein; SPTR: Putative uncharacterized protein; PFAM:
FT                   Yqey-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47015"
FT                   /db_xref="GOA:E6S8P6"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8P6"
FT                   /protein_id="ADU47015.1"
FT                   /translation="MSTLKDQLKADLTAAMRSRDQVRAGTIRMALTAVTTEEVAGTQHR
FT                   ELTDDDVLKVLAKEAKKRREAAEAYTTAGRTELADTEQAELAVLEGYLPKQLDESELEA
FT                   IVREAVAGSGASGMQQMGLAMKAANAAVAGRAEGGRVAAIVRRVLAG"
     atgagcactc tcaaggacca gctgaaggcg gacctcacgg cggcgatgcg atcccgcgac        60
     caggtgcggg ccggcacgat ccgcatggcc ctgaccgcgg tcacgaccga ggaggtcgcg       120
     gggacgcagc accgcgagct gaccgatgac gacgtcctca aggtgctcgc caaggaagcg       180
     aagaagcgtc gagaggccgc ggaggcctac acgaccgccg gccgcaccga gctggccgac       240
     acggagcagg ctgagctcgc cgtcctcgag ggctacctgc cgaagcagct cgacgagtcc       300
     gagctcgagg cgatcgtccg ggaggccgtg gccggatccg gtgcgagcgg catgcagcag       360
     atgggcctgg cgatgaaggc cgccaacgcc gccgtcgcgg gacgagccga gggtggccgg       420
     gtcgctgcga tcgtccgcag ggtgctcgcc ggctga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page