(data stored in SCRATCH zone)

EMBL: CP002343.PE454

CP002343.PE454       Location/Qualifiers
FT   CDS_pept        complement(510623..513058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0469"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="COGs: COG0744 Membrane carboxypeptidase
FT                   (penicillin-binding protein); InterPro IPR001264:
FT                   IPR001460; KEGG: kse:Ksed_25450 membrane carboxypeptidase
FT                   (penicillin-binding protein); PFAM: glycosyl transferase
FT                   family 51; penicillin-binding protein transpeptidase;
FT                   PRIAM: Peptidoglycan glycosyltransferase; SPTR: Putative
FT                   transpeptidase; PFAM: Penicillin binding protein
FT                   transpeptidase domain; Transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47016"
FT                   /db_xref="GOA:E6S8P7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8P7"
FT                   /protein_id="ADU47016.1"
FT                   /translation="MSSSRTTSIGGVISLLGAFLAAALVLGLLAAGLFMPAVGATGAIA
FT                   RSGVDIFNELPGEFKTDPLSQQSRILAADGRVIATPAEQNRIIVPLKNVAPIMREAQVA
FT                   IEDHRFYDHGGFDLQGVVRAAIANLRTGQTTSGASSLTQQYVKISLQYSALNQGDKAAA
FT                   QAAVRKDYMRKLKELKYAITLEKKMTKDEILQGYLNLVYYGDQAYGVEAASRHYFSIPA
FT                   SKLSLSQAALLAGLTQNPGTTDPVNYPERALARRNVVLDRMHELGRISDKEWTDAKKRT
FT                   LKQDLKVSQPKSTCLASPYPYWCEFVINYVETMPELGKTVEARRRLLRTGGITVQTTLD
FT                   PKIQRIVQEEVTRKVPIGDPSGVGAAAYVTEPGTGRVLAFAQNTKYTVGKQSRGKTGVS
FT                   WALDKRWGGSGGFQFGSTAKAFSLLTAMESGMSTKASVKAKAAGDKPATYQPSEFAKGC
FT                   GPGTEWKVLNDTPFKGGSISLMKATALSTNTAFVALAQQLGGCKVWDTMNRLGLRTASG
FT                   QPVPKYAPAYILGAAEVSPQGVAHAYATLAADGKKCSMVVVTKVTQGSKTLAAPKTKCD
FT                   QVAKADYVRGTDKFLEYNMTNGSGVRNQLDGRESAGKTGTSDKNNESWFVGYTPNLVTS
FT                   VWVGTPDDGNKRLMKNVRVGGQFYPVMHGASIAAPIWKGIMNRALEGEPVLRFKEPSDK
FT                   VLNGELVDIPSVTGRTVADATKILEEAGFHRRRRRLDGVEHPQGPRRRHVTVRPGTPGQ
FT                   RRHDLHVRGPEPADEQGQARSEADHHDRAAPRPEADEATAPQAQLHGDRGPAQRLRAG"
     atgtcgtcct cccgcaccac gtccatcggc ggcgtcatca gcctgctcgg cgcgttcctc        60
     gcggcagccc tggtgctcgg cctcctcgcg gccggtctct tcatgcctgc ggtcggtgcg       120
     accggcgcca tcgctcgcag cggcgtcgac atcttcaacg agctgccggg cgagttcaag       180
     accgacccgc tgagccaaca gtcgcgcatc ctcgccgcgg acgggagggt catcgcgacc       240
     ccggcggaac agaaccgcat catcgtgccg ctgaagaacg tcgcaccgat catgcgcgag       300
     gcgcaggtcg cgatcgagga ccaccgcttc tacgatcacg gcggcttcga cctgcagggt       360
     gtcgtccggg ctgcgatcgc caacctccgc accggtcaga ccacctccgg cgcatcctcc       420
     ctgacgcagc agtacgtcaa gatctcgctc cagtactccg cgctcaacca gggcgacaag       480
     gcggcggcgc aggccgcggt ccgcaaggac tacatgcgca agctcaagga gctgaagtac       540
     gccatcaccc tcgagaagaa gatgacgaag gacgagatcc tccagggcta cctcaacctc       600
     gtctactacg gcgaccaggc ctacggcgtc gaggccgcct cccgccacta cttctcgatc       660
     ccggccagca agctcagcct gtcgcaggcg gcactcctcg cgggtctgac gcagaacccc       720
     ggcacgaccg acccggtgaa ctacccggag cgcgccctcg cgcggcgcaa cgtcgtcctc       780
     gaccggatgc acgagctcgg caggatctcc gacaaggagt ggaccgacgc caagaagcgc       840
     acgctcaagc aggacctcaa ggtctcgcag ccgaagagca cctgcctcgc ctcgccgtac       900
     ccctactggt gcgagttcgt catcaactac gtcgagacca tgccggagct cggcaagacg       960
     gtcgaggcgc ggcggcggct gctccgcacc ggcggcatca cggtgcagac gaccctcgac      1020
     ccgaagatcc agaggatcgt ccaggaggag gtcacccgca aggtccccat cggtgacccg      1080
     tccggtgtcg gcgcggcggc gtacgtcacc gagcccggca cgggccgcgt cctcgccttc      1140
     gcccagaaca cgaagtacac cgtgggcaag cagagccgcg ggaagaccgg cgtgtcgtgg      1200
     gcactcgaca agcggtgggg cgggtccggg ggcttccagt tcggctccac ggccaaggcg      1260
     ttctccctgc tgaccgcgat ggagtccggg atgagcacca aggccagcgt caaggccaag      1320
     gccgcgggcg acaagccggc cacctaccag ccgagcgagt tcgcaaaggg ctgcgggccc      1380
     gggaccgagt ggaaggtcct caacgacacc ccgttcaaag gcgggtcgat ctccctgatg      1440
     aaggcgaccg cgctgtccac caacaccgcg ttcgtggccc tcgcccagca gctcggcggc      1500
     tgcaaggtgt gggacacgat gaaccgcctc ggcctgcgca cggcgagcgg ccagcccgtg      1560
     ccgaagtacg cgccggccta tatcctgggc gctgccgagg tctcgcccca gggcgtggcc      1620
     cacgcctacg ccaccctcgc tgcggacggc aagaagtgct cgatggtcgt cgtcaccaag      1680
     gtgacgcagg gctccaagac cctcgcggcg ccgaagacca agtgcgacca ggtcgcgaag      1740
     gccgactacg tccgcgggac cgacaagttc ctcgagtaca acatgaccaa cggctcgggc      1800
     gtgcgcaacc agctcgacgg gcgagagtcg gccggcaaga cgggtacgtc cgacaagaac      1860
     aacgagtcgt ggttcgtcgg ctacacgccg aacctcgtca cgtccgtctg ggtcggcacc      1920
     cccgacgacg gcaacaagcg cctcatgaag aacgtgcggg tcggcgggca gttctacccc      1980
     gtcatgcacg gtgcgtcgat cgcggcgccg atctggaagg gcatcatgaa ccgggccctc      2040
     gagggcgagc cggtcctgag gttcaaggag ccgtcggaca aggtcctcaa cggcgagctc      2100
     gtcgacatcc cgagcgtcac cggtcggacc gtcgccgacg ccacgaagat cctcgaggag      2160
     gccggctttc accgtcgacg tcggcggctc gatggggtcg agcatcccca agggcctcgt      2220
     cgccggcacg tcaccgttcg cccgggcacc ccagggcagc gtcgtcacga tctacacgtc      2280
     cgagggcccg agccagccga cgaacaaggg caagcccgat ccgaagccga ccatcacgat      2340
     cgagccgccc cccgaccaga agccgacgaa gccaccgccc cccaagccca actccacggc      2400
     gaccgcggac cagcccagcg cctgagggca ggctga                                2436
//

If you have problems or comments...

PBIL Back to PBIL home page