(data stored in ACNUC7421 zone)

EMBL: CP002343.PE456

CP002343.PE456       Location/Qualifiers
FT   CDS_pept        complement(513714..514934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0471"
FT                   /product="arsenite efflux ATP-binding protein ArsA"
FT                   /note="COGs: COG0003 ATPase involved in chromosome
FT                   partitioning; KEGG: tbi:Tbis_0197 anion-transporting
FT                   ATPase; SPTR: Putative ion-transporting ATPase; PFAM:
FT                   Anion-transporting ATPase; TC 3.A.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47018"
FT                   /db_xref="GOA:E6S8P9"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8P9"
FT                   /protein_id="ADU47018.1"
FT                   /translation="MTQTPHTPAHPPAHSPAHVRAAQAAPRLDIDAMIADRSVEVVVCC
FT                   GAGGVGKTTTAAALGLRAAEAGRRVVVLTIDPARRLAQALGLSELDNTPRPVVGFDASA
FT                   GGSLDAMMLDMKRTFDEVVLAHADPGKAEQILANPFYQAVSSSFAGTQEYMAMEKLGQL
FT                   KAAAGSSPDGWDLIIVDTPPSRSALDFLDAPNRLGSFLDGRFIRLLSAPAKASGRAGVK
FT                   VFGLGVQLVSSTMTKILGGQFLTDVQTFVAALDTMFGGFRERADETYRLLSRAGTSFLV
FT                   VAAPERDALREASYFVDRLQADRMPLSGLVVNRMGRVSAGALTPSRALSVAEALEDRGG
FT                   PKSAENAAGLLRLHAAVVTIAQRQRELAERFSRSHPDVPVRQIPALNRDVHDLESLREI
FT                   GNALAGP"
     atgacccaga ccccgcacac cccggcccac ccgcccgccc actcgccggc acacgtccgg        60
     gctgcccagg ccgccccgcg actcgacatc gacgcgatga tcgccgaccg gtcggtcgag       120
     gtcgtcgtct gctgcggtgc cggtggggtc ggcaagacga cgaccgcggc cgcacttggg       180
     ctgcgggccg cggaggccgg gcggcgggtc gtcgtgctga cgatcgaccc cgcgcgccgg       240
     ctcgcccagg ccctggggct gagcgagctg gacaacacgc cgcggcccgt cgtcggcttc       300
     gacgcgtccg cgggcggcag cctcgacgcg atgatgctcg acatgaagcg gaccttcgac       360
     gaggtggtcc tcgctcacgc cgaccccggc aaggccgagc agatcctcgc caacccgttc       420
     taccaggcgg tcagctcgtc gttcgccggc acgcaggagt acatggcgat ggagaagctc       480
     ggccagctca aggccgcggc cggctcctcc ccggacgggt gggacctcat catcgtcgac       540
     accccgccgt cccgctcggc cctcgacttc ctcgacgccc cgaaccggct cggcagcttc       600
     ctcgacggac ggttcatccg gctgctcagc gccccggcca aggcgagcgg ccgcgccggg       660
     gtgaaggtct tcggcctcgg cgtgcagctc gtgagcagca ccatgacgaa gatcctcggt       720
     ggacagttcc tcaccgacgt ccagacgttc gtcgcggcgc tcgacacgat gttcggcggc       780
     ttccgcgagc gcgccgacga gacctaccgg ctgctgtccc gcgcgggcac gtcgttcctc       840
     gtcgtcgccg cccccgagcg agacgccctc cgcgaggcgt cctatttcgt cgaccggctc       900
     caagcggacc gtatgccgct gagcgggctc gtcgtcaacc gcatgggtcg ggtgtcggct       960
     ggggcgctga cgccctcccg cgcgctgtcc gtcgccgagg cgctcgagga ccgcggtggg      1020
     ccgaagtcgg ccgagaacgc ggcggggctg ctgcgcctgc acgctgccgt ggtcaccatc      1080
     gcgcagcgcc aacgcgagct ggccgaacgg ttctcccgct cgcacccgga cgtgcccgtc      1140
     cgccagatcc cggcgctgaa ccgggacgtc cacgacctgg agagtctccg agagatcggg      1200
     aacgcgcttg ctgggccgtg a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page