(data stored in ACNUC7421 zone)

EMBL: CP002343.PE457

CP002343.PE457       Location/Qualifiers
FT   CDS_pept        complement(514931..515974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0472"
FT                   /product="arsenite efflux ATP-binding protein ArsA"
FT                   /note="COGs: COG0003 ATPase involved in chromosome
FT                   partitioning; KEGG: kfl:Kfla_0448 anion-transporting
FT                   ATPase; SPTR: Putative uncharacterized protein; PFAM:
FT                   Anion-transporting ATPase; TC 3.A.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47019"
FT                   /db_xref="GOA:E6S8Q0"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8Q0"
FT                   /protein_id="ADU47019.1"
FT                   /translation="MTDAHAIGAPEWQRARLHVVTGKGGTGKTTAASALALALASGSGT
FT                   PRRVLLAEVEGRQGISQTFDVPPLGTDETRIARTRSGGEILGLSVDAKAALLEYLQLFY
FT                   KLGRAGKLLEKFGAIDFATTIAPGVRDVLLIGRLYEANRRRRDGRHRGASPAAYDAIVM
FT                   DAPPTGRIGRFLSVNSEVADLARVGPIHSQAESITDLLESEQTLVHIVTLLEEMPVQET
FT                   LEAVRELRSKDLRVGLIFVNMVRDPLLDDVALEQARTGRLHKPSISSQLADAGVTATPE
FT                   LVDGLLEEAYDHAHRVDLETEQLALLEETGLPLVILPALPEGVDSGSVRELADILLDEL
FT                   EEVGLAR"
     gtgacggatg cccacgcgat cggcgcgccc gagtggcagc gcgcccgcct gcacgtcgtc        60
     accggcaagg gcggcaccgg caagacgacc gccgcctcgg ccctcgcgct ggccctcgcc       120
     tccgggtccg gcacccccag acgcgtcctg ctcgccgagg tcgaggggcg tcaggggatc       180
     agccagacct tcgacgtccc accgctgggc accgacgaga cgcggatcgc ccggaccagg       240
     tccggcggcg agatcctcgg cctctccgtc gacgccaagg cggcgctcct cgagtacctc       300
     cagctgttct acaagctcgg ccgcgccggc aagctcctcg agaagttcgg ggccatcgac       360
     ttcgccacga ccatcgcacc cggcgtccgg gacgtcctgc tcatcggcag gctctacgaa       420
     gccaaccgac gccggaggga cggccggcac cgaggagcga gcccagcggc atacgacgcg       480
     atcgtcatgg acgccccgcc cacgggacgc atcggacgct tcctcagcgt caactcggag       540
     gtcgccgacc tcgcccgcgt cggcccgatc cacagccagg ccgagtcgat caccgacctg       600
     ctcgagagcg agcagaccct cgtgcacatc gtcaccctgc tcgaggagat gccggtgcag       660
     gagaccctcg aggcggtccg ggagctgcgg tccaaggacc tgcgcgtcgg tctcatcttc       720
     gtcaacatgg tccgcgaccc cctcctcgac gacgtggcgc tcgagcaggc ccgcaccgga       780
     aggctgcaca agccgtccat cagcagccag ctcgccgacg ccggagtcac ggccaccccc       840
     gagctcgtcg acgggctgct cgaggaggcc tacgaccacg cgcaccgggt cgacctcgag       900
     accgagcagc tcgcgctcct cgaggagacc ggcctcccgc tggtgatcct cccggcgctg       960
     cccgagggcg tcgactccgg ctcggtccgc gagctcgccg acatcctgct cgacgagctc      1020
     gaggaggtgg gactggcgcg atga                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page