(data stored in ACNUC7421 zone)

EMBL: CP002343.PE458

CP002343.PE458       Location/Qualifiers
FT   CDS_pept        516145..517083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0473"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_0019 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47020"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8Q1"
FT                   /protein_id="ADU47020.1"
FT                   /translation="MVDERVVLDKAQGVAADRGGVASRALLADVGVHRHHIRQEVLRGR
FT                   WALHGRHTVAVHTRVLTQEELFWRAVWEVSASAAVLDGVSALIAAGLRGFDEEAVHVSV
FT                   VHNRRSAKAPGVRVHHLPRRCSDEVIGAGVPRVRPALAAVRAAHWAVSDRQAALILAMT
FT                   VQQRLCSSAQLLAAVEVIRGRRRRALVKGVVLDVAGGAQSLGELDLAGMCRRHGLPEPD
FT                   RQVIREDPTGRRYLDCRWRCGLVAEIDGAGHRWGLAVTDDNLRLNEVVVGGEQVLRFDT
FT                   LGLRLREGQFMTQLRAGLHALGEPGVEAPSG"
     gtggtggacg agagagtggt gctcgacaag gcgcaggggg tcgctgccga ccggggcggc        60
     gtggcctcgc gtgccctgct ggccgacgtc ggggtgcacc ggcaccacat ccgccaggag       120
     gtgctccgag ggcgctgggc gctgcacggc cggcacaccg tcgctgtcca cacccgcgtg       180
     ctgacgcagg aggagctgtt ctggcgagcc gtttgggagg tcagcgcatc cgctgcggtc       240
     ctcgacgggg tcagtgcgtt gatcgctgcg gggctcaggg ggttcgacga ggaagcggtg       300
     cacgtgtcgg tggtgcacaa ccggcgctca gcgaaggcgc ctggcgtgcg ggtgcaccac       360
     ctcccgcggc ggtgctcgga cgaagtgatc ggtgcgggtg tgccgcgcgt gcggccggcc       420
     ctggcagccg tcagggccgc ccactgggcc gtctctgatc gccaagctgc cctcatcctc       480
     gccatgacgg tgcagcagcg gttgtgctcg tccgcccagc tgctggctgc tgtcgaggtg       540
     atccggggcc gtcgccggcg cgccctggtc aagggtgtgg tcctggacgt cgcgggaggc       600
     gcccagtccc tcggtgagct ggacctcgcc gggatgtgcc gtcgacacgg cctcccggag       660
     cccgatcgac aggtgatccg agaggatccg acggggcgcc gctacctcga ctgccgctgg       720
     agatgcgggc tcgtcgccga gatcgacggt gcgggtcacc gttggggtct ggccgtcacc       780
     gacgacaacc tgcgcctcaa cgaggtcgtc gtcggtggcg agcaggtgtt gcgcttcgac       840
     accctcgggt tgcggcttcg agagggacag ttcatgacgc agctccgcgc tgggctgcac       900
     gcgctcgggg agccgggtgt cgaggccccc tcgggttga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page