(data stored in ACNUC7421 zone)

EMBL: CP002343.PE46

CP002343.PE46        Location/Qualifiers
FT   CDS_pept        50983..51915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0046"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_1866 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46608"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEK7"
FT                   /protein_id="ADU46608.1"
FT                   /translation="MSARAVWPELPVASWEPTRDTLTLWLQVIGKIRIARTPLLNHWWN
FT                   APLYVTTRGLTTSPIPGDAGRSLAIDLDLLDHRLDVTTTRGERRSMALEPKSVKDFHAE
FT                   LHGLLGGVGLATEIWPVPVELPEAIRFDEDTTHHDYDPEAVTAFWRTLVEVQRVFEVFR
FT                   SRFLGKSSPVHLFWGALDLATTRFSGKGAPPHPGGMPNCGPHVMHEAYSHEVSSCGYWP
FT                   GAEGEGIFYAYAYPDPDGYRDLPPGPAGARWDDELGEFVLPYTAVRTAQDPDAVLLDFL
FT                   QSTYAAAATTAGWDRAALERPALERPARA"
     atgagcgccc gcgcggtctg gcccgagctg cccgtggcga gctgggagcc gacccgcgac        60
     accctgacgc tgtggctcca ggtgatcggc aagatccgga tcgcgcgcac ccccctgctc       120
     aaccactggt ggaacgcgcc cctctacgtc accacccgcg gcctcaccac ctctcccatc       180
     cccggcgacg cgggtcggag cctcgccatc gacctcgacc tgctcgacca tcggctcgac       240
     gtgacgacca cgaggggcga gcgccgcagc atggccctcg agccgaagtc ggtcaaggac       300
     ttccacgccg agctccacgg actcctcggc ggcgtgggcc tggccaccga gatctggccg       360
     gtgccggtcg agctccccga ggcgatccgg ttcgacgagg acaccacgca ccacgactac       420
     gaccccgagg ccgtgacggc gttctggcgc acgctggtcg aggtgcagcg ggtcttcgag       480
     gtcttccggt cccgattcct gggcaagtcg agcccggtgc acctcttctg gggcgccctc       540
     gacctggcga cgacgcggtt ctccggcaag ggcgccccgc cacacccggg gggcatgccg       600
     aactgcggcc cccacgtgat gcacgaggcc tactcccacg aggtcagcag ctgcggctac       660
     tggccggggg cggagggtga gggcatcttc tacgcgtacg cctaccccga cccggacggc       720
     taccgcgacc tgccccccgg tccggccggc gcgcggtggg acgacgagct gggcgagttc       780
     gtcctgccct acaccgcggt ccggaccgcc caggacccgg acgccgtgct cctcgacttc       840
     ctgcagagca cctacgcggc ggcggcgacc accgcgggct gggaccgcgc ggccctggag       900
     cgcccggccc tggagcgccc cgcccgggct tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page