(data stored in ACNUC7421 zone)

EMBL: CP002343.PE462

CP002343.PE462       Location/Qualifiers
FT   CDS_pept        518393..519226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0477"
FT                   /product="NUDIX hydrolase"
FT                   /note="InterPro IPR000086; KEGG: kse:Ksed_25420 NUDIX
FT                   family protein; PFAM: NUDIX hydrolase; SPTR: NUDIX family
FT                   protein; PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47024"
FT                   /db_xref="GOA:E6S8Q5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR039121"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8Q5"
FT                   /protein_id="ADU47024.1"
FT                   /translation="MTPPRDFPLTQVRGLGDVALRWLRGERWDEAAPRQASTVMLVRDG
FT                   ERGTEVFMLKRVSQMAFAPSMHVFPGGGVDPRDGDAGLPWAGPSPAEWASRLRCTAAEA
FT                   QMFVAAAVREVFEEVGVLLAGPSPSSPLVDPHDGSWAGVRDRLVSRDLSLAGVLRERDL
FT                   VLRSDLIVAKAHWLTPAFEPRRFDTWFFAAVMPEHQVADGETSEAETAEWVVPQELLEA
FT                   YAAGLASLLPPTVMCVEEIADAPSAVAFVRHSDDLPLIMPVVVDTPEGPAMRIDV"
     atgacgccgc cccgggactt ccccctgacg caggtccgcg gcctgggcga cgtcgccctg        60
     cgctggcttc gcggcgagcg gtgggacgag gcggccccgc ggcaggcgag caccgtcatg       120
     ctcgtgcgtg acggtgagcg gggcaccgag gtgttcatgc tcaagcgggt gtcgcagatg       180
     gcgttcgcgc cgagcatgca cgtcttcccg ggcggtggcg tcgacccgcg cgacggggac       240
     gccgggctgc cgtgggccgg tccatcgccg gccgagtggg cgagccgtct gaggtgcacc       300
     gcggccgagg cgcagatgtt cgtcgccgcc gcggtccggg aggtcttcga ggaggtcggc       360
     gtcctcctgg ccgggccgtc tccgagcagt cccctcgtcg acccccacga cgggagctgg       420
     gcgggggtgc gcgacaggct ggtctcgcgt gacctctcgc tggccggggt gctgcgagag       480
     cgtgacctcg tgctccgctc ggacctcatc gtcgcgaagg cgcactggct gaccccggcg       540
     ttcgagccgc ggcggttcga cacgtggttc ttcgccgcgg tgatgccgga gcaccaggtc       600
     gccgacggtg agacgagcga ggccgagacc gcggagtggg tcgtccccca ggagcttctc       660
     gaggcgtatg ccgctgggct cgcctccctg ctcccgccga cggtcatgtg cgtggaggag       720
     atcgcagacg cgcccagtgc ggtggcgttc gtccggcaca gcgacgacct cccgctcatc       780
     atgccggtgg tcgtcgacac gcccgagggg ccggcgatgc ggatcgacgt ctga             834
//

If you have problems or comments...

PBIL Back to PBIL home page