(data stored in ACNUC7421 zone)

EMBL: CP002343.PE465

CP002343.PE465       Location/Qualifiers
FT   CDS_pept        521062..521796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0480"
FT                   /product="endonuclease III; DNA-(apurinic or apyrimidinic
FT                   site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /EC_number="3.2.2.-"
FT                   /note="COGs: COG0177 EndoIII-related endonuclease;
FT                   InterProIPR003265: IPR003651: IPR004035: IPR004036: IPR
FT                   005759; KEGG: kfl:Kfla_0455 endonuclease III; PFAM: HhH-GPD
FT                   family protein; iron-sulfur cluster loop; PRIAM:
FT                   DNA-(apurinic or apyrimidinic site) lyase; SMART: HhH-GPD
FT                   family protein; iron-sulfur cluster loop; SPTR: Putative
FT                   endonuclease III; TIGRFAM: endonuclease III; manually
FT                   curated; PFAM: HhH-GPD superfamily base excision DNA repair
FT                   protein; Iron-sulfur binding domain of endonuclease III;
FT                   Helix-hairpin-helix motif; TIGRFAM: endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47027"
FT                   /db_xref="GOA:E6S8Q8"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8Q8"
FT                   /protein_id="ADU47027.1"
FT                   /translation="MSSVSARAVVTADESPVARTRRARAMYRALHDRYPYAHCELDFTT
FT                   PLELLVATILSAQTTDVGVNKVTPIVFAKYRTAADYAAADRTELETIIQPTGFFRAKSD
FT                   SLIKLGQALVERFDGEVPGRLKDLVTLPGVGRKTANVVLGNAFNVPGITVDTHFGRLVR
FT                   RFGWTAEEDPVKVEHAVGALFLRRDWTMLSHVVIFHGRRTCHAKKPACGACPVARWCPS
FT                   YGIGETDPERAARLLKFELAPK"
     gtgtcgtctg tgtctgcccg tgccgtcgtg accgccgacg agagccctgt cgcacggacc        60
     cggcgcgcgc gcgcgatgta ccgggcgctc cacgaccgct acccgtacgc gcactgcgag       120
     ctcgacttca ccacgcctct cgagctgctc gtcgcgacga tcctctcggc gcagaccacg       180
     gacgtcggcg tcaacaaggt gaccccgatc gtcttcgcga agtaccgcac cgcggcggac       240
     tacgcggcgg ctgaccggac cgagctcgag acgatcatcc agccgaccgg cttcttccgc       300
     gccaagtccg acagcctgat caagctcggc caggccctcg tcgagcggtt cgacggggag       360
     gtcccggggc ggctcaagga cctcgtcacg cttcccggcg tgggccgcaa gaccgccaac       420
     gtcgtcctcg gcaacgcctt caacgtgccg ggcatcaccg tggacacgca cttcggccgt       480
     ctcgtgcgcc gcttcggctg gactgccgag gaggacccgg tcaaggtcga gcacgcggtc       540
     ggcgcgctgt tcctgcgccg cgactggacg atgctcagcc acgtcgtcat cttccacggc       600
     cggcgcacct gccacgccaa gaagcccgcc tgcggagcct gcccggtcgc gcggtggtgc       660
     cccagctacg gcatcggcga gaccgacccg gagcgcgccg cacggctgct caagttcgag       720
     ctggccccga agtga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page