(data stored in ACNUC7421 zone)

EMBL: CP002343.PE470

CP002343.PE470       Location/Qualifiers
FT   CDS_pept        complement(525802..526329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0485"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: mjl:Mjls_3247 integral membrane protein; SPTR:
FT                   Putative integral membrane protein; PFAM: Tripartite
FT                   tricarboxylate transporter TctB family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47032"
FT                   /db_xref="GOA:E6S8R3"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8R3"
FT                   /protein_id="ADU47032.1"
FT                   /translation="MSDPQVDTTGAAAKPREDRAQYGVCAALAGLGVLLLVDAANIRHV
FT                   TSSNDPLGPRPVPIVLGVLLLITAVSYAIDVWRGGVGQAEGGEDVDLGSRADWKTVGLL
FT                   IVVFGASALLIQPLGWVITGSLLFWGCAYALGNEHHVRGLAFGIALALTTFYGFAIGLG
FT                   VNLPAGILKGIL"
     atgtctgacc cccaggtgga caccaccggt gccgccgcga agccccgcga ggaccgcgca        60
     cagtacgggg tgtgcgcggc cctcgcgggc ctcggcgtgc tgctgctcgt cgacgccgcg       120
     aacatccgcc acgtcacgag cagcaacgac ccgctcggtc cgcggccggt ccccatcgtc       180
     ctcggcgtgc tcctgctcat caccgccgtc tcctacgcca tcgacgtctg gcgcggtgga       240
     gtcggccagg ccgagggcgg cgaggacgtc gacctcggca gccgggccga ctggaagacc       300
     gtcggcctcc tcatcgtcgt cttcggcgcg agcgccctgc tcatccagcc gctcggctgg       360
     gtcatcaccg gcagcctcct cttctggggc tgcgcctacg ccctcggcaa cgagcaccac       420
     gtccgcggcc tggcctttgg gatcgccctc gcgctgacca ccttctacgg cttcgccatc       480
     ggcctcggcg tcaacctccc ggccggcatc ctcaagggaa tcctctga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page