(data stored in ACNUC7421 zone)

EMBL: CP002343.PE472

CP002343.PE472       Location/Qualifiers
FT   CDS_pept        527454..529136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0487"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="COGs: COG3290 Signal transduction histidine kinase
FT                   regulating citrate/malate metabolism; InterPro IPR005467:
FT                   IPR013767: IPR003594: IPR004358; KEGG: sco:SCO1137 two
FT                   component system histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; PAS fold domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; SPTR: Putative
FT                   two component system histidine kinase; PFAM: Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47034"
FT                   /db_xref="GOA:E6S8R5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8R5"
FT                   /protein_id="ADU47034.1"
FT                   /translation="MKVEFFVVMRRLRRFTLAGQLLVAQVAILLTVLIAVAFVSLAQSE
FT                   ATFTRTEGRRLFAIAEQLASHPLVRQELAPPQVINALPTVVQGTITQYGLALVSVADSR
FT                   GVVKDSSDPTTEERQLPLGSERVRQGASWTGPMELAGRRMLAAQTPVLYSPGTNVPAAG
FT                   GLSPGTRLGTVMVAVEMPSVIDRLQGASSYLLTYLGLALALGGLGSWLLARRLKRQTLG
FT                   LEPHEITGLAESREAMLFGLAEGVVALDTSNRITLVNNVAQRLLDLPERAVGMSVSDLA
FT                   IGPRLREVLLGQTGDEPDQVVLRRGRVLVMNRMEVAKDGRPLGSVTTLRDRTELAALER
FT                   EIGSFRSSTELLRAQAHEFANQLHTISGLIQLGEYDEVVRFVDSVSQHRAQLDLTVARR
FT                   IQDTAVSALVMAKAAQATERRVELRVSDDTALGRMSSVDSADLAAVVGNLVDNAVDAAA
FT                   TAGGDERWVELAIHQDASSPRSTVEVMVSDSGPGVAPELVTEVFTHGFTTKAAEAGERG
FT                   IGLALTRLICQRRGGEVEVERTEEGATFIARLTVDSPALQESR"
     atgaaggttg agttctttgt ggtcatgcgt cgactgcgcc gattcacgct cgccgggcag        60
     ctcctggtcg cccaggtggc gatcctgctg accgtgctga tcgcggtcgc gttcgtctcg       120
     ctcgcgcagt cggaggcgac gttcacccgc accgagggtc ggcgcctctt cgccatcgcc       180
     gagcagctcg cgagccaccc gctcgtgcgt caggagctgg cgccgccgca ggtcatcaac       240
     gccctgccga cggtcgtcca gggcaccatc acgcagtacg gcctggcact cgtgtcggtc       300
     gcggactcga ggggcgtcgt caaggactcg tcggacccga cgacggagga gcggcagctg       360
     ccgctcgggt cagagcgggt gcgccagggt gcgagctgga ccggcccgat ggagctcgcc       420
     ggtcggcgga tgctcgcggc ccagacgccg gtcctctact cgccgggcac gaacgtgccg       480
     gcagccgggg gcctgtcgcc cgggacccgg ctcggcaccg tcatggtcgc cgtcgagatg       540
     ccgtcggtca tcgaccgcct ccagggtgcc tcctcctacc tgctgaccta cctcggcctc       600
     gctctcgccc tgggtggcct cgggtcctgg ctcctcgccc ggcgcctcaa gcggcagacc       660
     ctcggcctcg agccgcacga gatcaccggg ctggccgaga gccgcgaggc gatgctgttc       720
     ggcctcgccg agggggtggt cgccctggac acgtcgaacc ggatcacctt ggtcaacaac       780
     gtcgcccagc gcctcctcga cctgccggag cgggcggtcg ggatgtccgt gtcggacctt       840
     gccatcgggc cgcggctgcg cgaggtgctc ctcgggcaga ccggcgacga gcccgaccag       900
     gtcgtcctgc gtcgggggag ggtgctggtc atgaaccgga tggaggtcgc caaggacggc       960
     cggccgctcg gctccgtgac gacgctccgc gaccgcaccg agctggccgc gctcgagcgg      1020
     gagatcggct cgttccgcag ctcgaccgag ctgctccggg cccaggcgca cgagttcgcc      1080
     aaccaactgc acaccatctc cgggctgatc cagctggggg agtacgacga ggtcgttcgg      1140
     ttcgtcgact cggtgagcca gcaccgggcc cagctcgacc tgacggtggc gcgacggatc      1200
     caggacacgg ccgtgtcggc gctcgtcatg gccaaggccg cccaggcgac cgagcggcgc      1260
     gtggagctgc gggtctcgga cgacacggcg ctcggccgga tgtcgtcggt ggactccgcc      1320
     gacctggccg cggtcgtcgg caacctcgtc gacaacgcgg tcgacgccgc ggcgacggcc      1380
     ggcggcgacg agcggtgggt cgagctggcg atccaccagg atgcgagcag cccgaggagc      1440
     acggtggagg tgatggtctc cgactcgggg ccgggggtcg cgcccgagct cgtcaccgag      1500
     gtcttcaccc acggcttcac gacgaaggcc gccgaggcgg gggagcgcgg catcggcctc      1560
     gccctgactc ggctcatctg ccaacggcgg ggcggcgagg tcgaggtgga gcggaccgag      1620
     gagggggcca ccttcatcgc gcgcctcacg gtcgactccc ctgccctgca ggagtcccga      1680
     tga                                                                    1683
//

If you have problems or comments...

PBIL Back to PBIL home page