(data stored in ACNUC7421 zone)

EMBL: CP002343.PE476

CP002343.PE476       Location/Qualifiers
FT   CDS_pept        complement(532122..533033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0491"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="COGs: COG0596 hydrolase or acyltransferase
FT                   (alpha/beta hydrolase superfamily); InterPro IPR000073:
FT                   IPR000639; KEGG: tbi:Tbis_0209 alpha/beta hydrolase fold
FT                   protein; PFAM: alpha/beta hydrolase fold; SPTR: Hydrolase;
FT                   PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47038"
FT                   /db_xref="GOA:E6S8R9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8R9"
FT                   /protein_id="ADU47038.1"
FT                   /translation="MPVDAAFVEIDGPWQHRHVAANGARFHVAELGDGPLVLMLHGYPQ
FT                   FWYTWRHQMVSLAEAGYRVAAMDLRGYGGSDKPPRGYDTYTATLDAASVIRALGEAEAT
FT                   IVGQGLGGWIAWAMPALRPDETTAVASLSMPHPRVMRRASWLNRKQRAASSWIVSLQRP
FT                   FGPERAMTRSHDYVGGLLRDWSAPGGDFPTPEDVARYGDAMMIPFVAHSAAEHYRWLGR
FT                   SQLRPDGPFFMRRIRHAIHVPVLELHGADDGCVLVSSIRGSEKYAAGDFRSVTIPRAGH
FT                   FLTEEAPDAVSAELLRWLKSVR"
     atgccggtcg acgctgcctt cgtcgagatc gacggaccgt ggcagcaccg acacgtcgct        60
     gcgaacggcg cgcgcttcca cgtcgccgag ctgggggacg gaccgctcgt cctcatgctg       120
     cacggctacc cgcagttctg gtacacgtgg cgccaccaga tggtctcgct cgccgaggcg       180
     gggtaccggg tcgccgcgat ggacctgcgc ggttacggcg gctccgacaa gccaccccgc       240
     ggctacgaca cctacacggc gacgctcgat gcggcgtcgg tgatccgcgc cctcggcgag       300
     gccgaggcca cgatcgtcgg gcaggggctc ggcggctgga tcgcttgggc gatgccggcg       360
     ctgcggcccg acgagacgac cgccgtcgcg tcgctctcga tgccgcaccc ccgcgtcatg       420
     cggcgtgcgt cgtggctcaa ccggaagcag cgggccgcct cctcgtggat cgtctcgctg       480
     cagcggccgt tcgggccgga gcgggcgatg acgcggtcgc atgactacgt gggcgggctg       540
     ctccgcgact ggtcggcgcc aggtggggac tttcccacgc ccgaggacgt cgcccgctac       600
     ggcgacgcga tgatgatccc gttcgtcgcg cactccgcgg cggagcacta ccgctggctg       660
     gggcggtcgc agctgcgccc cgacgggccg ttcttcatgc ggcggatccg ccacgccatc       720
     cacgtgcccg tgctcgagct gcacggcgcc gacgacgggt gcgtcctggt cagctcgatc       780
     cgcgggtccg agaagtacgc ggcgggggac ttccgttcgg tgacgatccc gcgcgccggt       840
     cacttcctga ccgaggaggc accggacgcc gtgtcggctg agttgctccg ctggctgaag       900
     tccgttcggt ag                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page