(data stored in ACNUC7421 zone)

EMBL: CP002343.PE477

CP002343.PE477       Location/Qualifiers
FT   CDS_pept        complement(533055..533642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nml:Namu_0724 protein of unknown function
FT                   DUF1469; SPTR: Putative uncharacterized protein; manually
FT                   curated; PFAM: Protein of unknown function (DUF1469)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47039"
FT                   /db_xref="GOA:E6S8S0"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8S0"
FT                   /protein_id="ADU47039.1"
FT                   /translation="MHRTVGWQEQAPRAQPITWRSEPMSTDPRQERTLGQLVAAATQDM
FT                   STLVRGEIALAKAEVSGQLKKAGKGGGLLAAAAVLGFYAVYFVFTTLVEVLDIWLPRWA
FT                   AWLIITVLMLLVAGILAMAGIRKMKTVEPTPKKAVAEAQQTVAALKAATANPGTMAAAP
FT                   RPEWDRPSTATLPSGTPVTAASDGTRSDTTNP"
     gtgcaccgca cagtagggtg gcaggagcaa gcgccgcgcg cgcagccgat cacgtggagg        60
     agtgaaccga tgagcacgga cccccggcag gagcggacgc tcgggcagct ggtcgccgcc       120
     gcgacccagg acatgtcgac gctggtccga ggggagatcg ccctggccaa ggcggaggtg       180
     tccggccagc tgaagaaggc cgggaagggc ggggggctcc tcgccgctgc ggccgtgctc       240
     ggcttctacg ccgtctactt cgtcttcacg acgctcgtcg aggtcctcga catctggctc       300
     ccccgctggg cggcgtggct catcatcacc gtcctcatgc tcctcgtcgc cggcatcctc       360
     gcgatggcgg gcatccgcaa gatgaagacc gtcgagccga cccccaagaa ggccgtcgcc       420
     gaggcccagc agacggtcgc cgcgctcaag gccgccaccg ccaaccccgg cacgatggcc       480
     gccgcacccc gacctgagtg ggaccggccg tcgaccgcga ccctcccctc gggcacgccc       540
     gtcactgcag ccagcgacgg gacgaggtcc gatacgacca atccctga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page