(data stored in ACNUC7421 zone)

EMBL: CP002343.PE478

CP002343.PE478       Location/Qualifiers
FT   CDS_pept        complement(533799..534236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0493"
FT                   /product="PEBP family protein"
FT                   /note="COGs: COG1881 Phospholipid-binding protein; InterPro
FT                   IPR008914: IPR005247; KEGG: drt:Dret_1202 PEBP family
FT                   protein; PFAM: PEBP family protein; SPTR: PEBP family
FT                   protein; PFAM: Phosphatidylethanolamine-binding protein;
FT                   TIGRFAM: Raf kinase inhibitor-like protein, YbhB/YbcL
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47040"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8S1"
FT                   /protein_id="ADU47040.1"
FT                   /translation="MKLTSSTFAEGQEIPEKCGKRAQNVSPHLTWSDEPAGTRSFALTV
FT                   VDWHPVARGYVHWMVCDIRPTTTTFMEGAAARGLPEGTRQVRAYAGPFPPSGTHDYVFT
FT                   LHALDIAAPNIPPGATLDEFNAAVSSHTLATATLTGHFTRR"
     atgaagctca cctcgtccac cttcgccgag ggccaggaga tccccgagaa gtgcggcaag        60
     cgagcgcaga acgtctcccc gcacctcacg tggtccgatg agcccgccgg cacccggtcc       120
     ttcgccctca ccgtcgtgga ctggcatccc gtcgcccggg gctacgtcca ctggatggtc       180
     tgcgacatcc gtccgacgac gacgaccttc atggaggggg ccgccgcccg tggtctgccg       240
     gagggcaccc gccaggtgcg ggcctacgcc ggccccttcc cgccgtcggg cacgcacgac       300
     tacgtgttca cgctccacgc cctggacatc gcggccccga acatccctcc gggcgccacg       360
     ctcgacgagt tcaacgcggc agtcagctcg cacacgctcg ccacggccac gctgaccggc       420
     cacttcacgc gccgctag                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page