(data stored in ACNUC7421 zone)

EMBL: CP002343.PE479

CP002343.PE479       Location/Qualifiers
FT   CDS_pept        complement(534534..535325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0494"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG0110 Acetyltransferase (isoleucine patch
FT                   superfamily); InterPro IPR001451; KEGG: bcv:Bcav_1182
FT                   acetyltransferase, putative; SPTR: Acetyltransferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47041"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8S2"
FT                   /protein_id="ADU47041.1"
FT                   /translation="MHNIKANKLTIGKGTFIDPSAVICGADGGPADVVTIGDNCYIGER
FT                   VQIRCPEFSLGDYGKIHHDTNVHGYSPCLIGHNAWIGQFTIIDSIGGVTIGDNCGIGAH
FT                   SQLWSHIKYGDTLEGCRFLSEKPLRIGKDVWFVGHCIVSPITAEDRSVAMVGSVVTRDM
FT                   KENRVYAGTPAADITDKTGPAFSPVNVEEKFLKMEEYLKAYGGDRSDLRIARTVNDISD
FT                   VNSTWFVVESRTYTKRGTASEVEFMKFLLPERGKFTPISTL"
     atgcacaata tcaaggccaa caaactcacg attggcaagg gaacgttcat cgatccgtct        60
     gcggtcatct gcggcgcgga tggagggccc gcagacgtgg tgacaattgg agacaactgc       120
     tatatcggcg agcgcgtcca aatccgttgc ccagagtttt ccttgggtga ctacggcaaa       180
     attcatcatg acaccaacgt tcatggatac agtccttgcc tcatcggaca caacgcgtgg       240
     atcgggcagt tcaccatcat cgactccatc ggtggggtca cgattgggga caactgtggc       300
     attggcgctc actcccagct atggagccat atcaagtatg gcgacaccct agaaggctgc       360
     cgcttcttgt ccgagaagcc tttgcgcatc ggcaaggatg tctggtttgt tgggcactgc       420
     atagtgtccc caattaccgc cgaagaccgc tctgttgcca tggttggtag cgtggtcacc       480
     cgagacatga aagagaatcg ggtttatgcc ggaactcccg ccgccgacat aactgacaag       540
     acgggcccag ccttttcgcc agtcaacgtg gaggagaaat tcctcaagat ggaggagtac       600
     ctcaaggcct atggtggcga ccgcagcgac ctgaggatcg cgcgaacagt caacgacata       660
     tcggacgtca attccacttg gttcgtcgtc gaatcacgca cttacacgaa gcgtggcact       720
     gccagtgaag tcgaattcat gaagtttcta ttgcctgaac gcggtaagtt cacgcctatc       780
     agcacactgt ag                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page