(data stored in ACNUC7421 zone)

EMBL: CP002343.PE480

CP002343.PE480       Location/Qualifiers
FT   CDS_pept        complement(535449..536603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0495"
FT                   /product="TDP-4-keto-6-deoxy-D-glucose transaminase"
FT                   /note="COGs: COG0399 pyridoxal phosphate-dependent enzyme
FT                   apparently involved in regulation of cell wall biogenesis;
FT                   InterPro IPR000653: IPR012749; KEGG: rer:RER_24530
FT                   TDP-4-oxo-6-deoxy-D-glucose transaminase; PFAM:
FT                   DegT/DnrJ/EryC1/StrS aminotransferase; SPTR: Putative
FT                   aminotransferase; TIGRFAM: TDP-4-keto-6-deoxy-D-glucose
FT                   transaminase; PFAM: DegT/DnrJ/EryC1/StrS aminotransferase
FT                   family; TIGRFAM: TDP-4-keto-6-deoxy-D-glucose transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47042"
FT                   /db_xref="GOA:E6S8S3"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8S3"
FT                   /protein_id="ADU47042.1"
FT                   /translation="MLRGVRQISFSTPYRTGLEEPYIAEALKSSVWHGDGQFTKRASDF
FT                   LTELTGATSTLLTTSGTHALELAAVALGLGPGDEVIVPTFTFPSTATAIALRGATPVFV
FT                   DVLPETLNLDIDATAAALTDRTRAIFVVHYGGVAADLDRLTELAAANDVAIVEDNAHGL
FT                   GAYYDGQHLGTFGTFGAQSWHDTKNFTCGEGGALLINDASLLSRAEIIREKGTNRSQFL
FT                   RGQVDKYTWVDQGSSYLPSELQAAVLMAQFEHYSEIQGKRHAVWDRYATDLKAWAADHG
FT                   VSLMTVPERRQHPAHLYYLLLPTHEDQQAFIASLAAESIVAPFHYQPLHASPAGKALGR
FT                   TPFPCDVADDRAHRLVRLPLHANLTESDLDRVVSAISSFVPIHG"
     atgctacggg gcgtgcgcca gatctccttc tccacgccat accgcaccgg gctcgaggag        60
     ccctacatcg ctgaggctct gaagtccagc gtctggcacg gggacggaca gttcaccaag       120
     cgggccagtg actttctcac cgagctgacg ggggccacgt cgacgctgct cacgacgagc       180
     gggacccacg ccctggagct cgcagcggtc gcgctcggcc tgggccccgg tgacgaggtc       240
     atcgtgccga cgttcacctt cccgtcgacc gcgaccgcca tcgccctgcg gggcgccact       300
     ccggtcttcg tcgacgtcct ccccgagacc ctcaacctcg acatcgacgc caccgccgcg       360
     gccctcaccg accggaccag ggccatcttc gtcgtccact acggcggagt cgcggccgac       420
     ctcgaccgac tcaccgagct cgcagcagcc aacgacgtcg ccatcgtcga ggacaacgcg       480
     cacggtctcg gcgcgtacta cgacgggcag cacctcggca ccttcggcac cttcggggcg       540
     cagagctggc acgacacgaa gaacttcacg tgcggcgagg gtggcgcgct gctgatcaac       600
     gacgcgtcgc tgctcagccg cgcggagatc atccgcgaga agggcaccaa ccgctcgcag       660
     ttcctgcgcg gccaggtcga caagtacacc tgggtcgacc agggctcctc ctacctgccc       720
     agcgagctgc aagcagccgt gctcatggcg cagttcgagc actactcgga gatccagggc       780
     aagcgccacg ccgtctggga ccgttacgcc acggacctca aggcgtgggc cgccgaccac       840
     ggcgtctccc tgatgaccgt tcccgagcgc cggcagcacc cggcgcacct ctactacctg       900
     ctcctgccga cgcacgagga ccagcaggcc ttcatcgcga gcctcgctgc cgagagcatc       960
     gtcgccccgt tccactacca gccgctgcac gcctcgccgg cgggcaaggc cctcggccgc      1020
     acccccttcc cgtgcgacgt cgccgacgac cgcgcgcacc gcctcgtccg gctcccgctc      1080
     cacgccaacc tcaccgagtc ggacctcgac cgcgtcgtct cggcaatttc tagctttgtg      1140
     ccgatccatg ggtga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page