(data stored in ACNUC7421 zone)

EMBL: CP002343.PE481

CP002343.PE481       Location/Qualifiers
FT   CDS_pept        536634..537056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0496"
FT                   /product="GtrA family protein"
FT                   /note="InterPro IPR007267; KEGG: kfl:Kfla_0511 GtrA family
FT                   protein; PFAM: GtrA family protein; SPTR: GtrA family
FT                   protein; PFAM: GtrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47043"
FT                   /db_xref="GOA:E6S8S4"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8S4"
FT                   /protein_id="ADU47043.1"
FT                   /translation="MNRWLSSSKLSSTLRWTHQPARYLVVAGTTSLVYLGLVAGGLALG
FT                   LHYIAAILVAQVITISFAFPAYRHWVFAPGAEWTKDLARFVSVWSSGAVAGLVMTPLLV
FT                   ELAGWPPMLAQVVALVVVSVGSYLSHRFFTFRHVSP"
     gtgaatcgct ggttgtcgtc ctcgaagctg tcctcgacgc tgcgctggac acaccagccg        60
     gcgcggtatc tcgtcgtcgc cgggacgacg agcctggtgt atctcgggct ggtcgcaggg       120
     ggcctcgcgc tcgggctgca ctacatcgcg gccatcctcg tggcccaggt catcacgatc       180
     tccttcgcct tccccgcgta ccggcactgg gtcttcgccc cgggcgccga gtggaccaag       240
     gacctggcgc gcttcgtgtc ggtgtggtcc tcgggcgccg ttgccgggct ggtgatgacg       300
     ccgctgctcg tcgagctcgc tgggtggccg ccgatgctgg cccaggtggt cgcgctggtc       360
     gtcgtgtcgg tcggctccta cctcagccac cggttcttca ccttccggca cgtctcgccc       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page