(data stored in ACNUC7421 zone)

EMBL: CP002343.PE486

CP002343.PE486       Location/Qualifiers
FT   CDS_pept        541706..542509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0502"
FT                   /product="Flp pilus assembly protein CpaB"
FT                   /note="InterPro IPR000169; KEGG: tcu:Tcur_1854 Flp pilus
FT                   assembly protein CpaB; SPTR: Putative uncharacterized
FT                   protein; TIGRFAM: Flp pilus assembly protein CpaB"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47048"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8S9"
FT                   /protein_id="ADU47048.1"
FT                   /translation="MNRRLVAVLLAVLLAIAGALLVVNYVRGADARAIADQQPAKVYLA
FT                   EKLIPAGTTLKDAQRTELIVETRVATVARPQGALDDINPENSALLALSDIQPGEFVMAS
FT                   RFGTRPVGEKAIEVPAGMLAMSVELSDPARIGKFVTPGSDIAIFATHGMKLIGEDDATK
FT                   AFNELNLKGTTVLLDKVQVIAMGDTPLAAPKKAEAGKADEQTPSFLVTVAVTPEQSLRL
FT                   AHGINEYTLYAGLRGSDVKIPADGHTDDSDIFSYDMRQLLKQVRR"
     atgaaccgcc gactcgtcgc agtcttgctc gccgtcttgc tcgccattgc cggtgcttta        60
     ctcgttgtca actatgtgcg gggcgccgac gcgcgggcga tcgctgatca gcagccggcc       120
     aaggtctacc tggctgagaa gctgatccca gcaggcacaa cgctcaagga tgcccagcgc       180
     acggagctca tcgtggagac gcgcgtggct accgtcgccc gaccccaagg ggcgctcgac       240
     gacatcaacc cggaaaacag cgctctcctc gcactttcgg acattcagcc cggcgagttc       300
     gtcatggcct cccgttttgg aacacgccca gtcggcgaga aggccatcga ggtgcccgca       360
     ggcatgctcg cgatgtcggt tgaactctcc gaccctgccc gaatcggaaa gttcgtgacg       420
     ccgggaagcg acatcgcgat ctttgcgact cacggcatga agctgatagg ggaggacgat       480
     gcgaccaagg ccttcaatga actgaacttg aaaggcacga cagtgcttct ggacaaggtt       540
     caggtcatcg ccatgggcga tacgcccttg gccgccccaa agaaggccga ggcaggcaag       600
     gcggacgaac agacgccaag tttcttggta acggtcgccg tcacaccgga gcagtccctg       660
     cggctggcgc acggcatcaa cgagtacacg ctgtatgccg gtttgcgcgg ttcggacgtc       720
     aagattcccg cggatggcca caccgatgac agcgatatct tcagttacga catgaggcag       780
     ctgctcaagc aggtgcgccg gtga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page