(data stored in SCRATCH zone)

EMBL: CP002343.PE487

CP002343.PE487       Location/Qualifiers
FT   CDS_pept        542506..543675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0503"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /note="COGs: COG0455 ATPase involved in chromosome
FT                   partitioning; KEGG: ace:Acel_0975 cobyrinic acid
FT                   a,c-diamide synthase; SPTR: Probable chromosome
FT                   partitioning ATPase; PFAM: CobQ/CobB/MinD/ParA nucleotide
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47049"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8T0"
FT                   /protein_id="ADU47049.1"
FT                   /translation="MTILWDLDPRAPQTYGFALGPDALQMHAAGQVGKALQEGKHALVV
FT                   IGPDIALDAACSLAELERVDRPELGVILLRHRVDVTTLAQALRSGVREVVQAGDQTSLS
FT                   DAIKRSLELTAQLSGHAHGPSAGAGKVITIFSAKGGVGKTTLATNLAAYLASTGAETLL
FT                   IDLDLMFGDVAISLQVVPAHDIGHLISMRGHLDEQGVHSVVSRHEDSGLAVIAAPSDPE
FT                   VADRVPAAVVEELLRVARGMFAYVIVDTPPNLTEHVLTACDLSDLTMLVATLDIPAVKN
FT                   LRVAMNALDTLGASKDGRVIVLNRSDAKVGLKADDVEVALQHEIRGQVPTSQSVPSSVN
FT                   RGVALVLDEPRSPVAVAIREIADREIRSRFGEQVENGSRRGFALLRSRK"
     gtgaccattt tgtgggattt ggatccccgc gctccccaga cctacgggtt tgcgctaggt        60
     cccgacgcgc tgcagatgca cgcggccggt caggtcggta aggccctaca agagggcaaa       120
     cacgccctcg tagtcatagg tccggacatt gctctggacg cagcctgttc gctggcggag       180
     ctcgagcgcg tcgaccggcc ggagctcggg gtgatccttc tcagacatcg cgtggatgtc       240
     acgacgctag cccaagccct tcgctccggt gtgcgggagg tcgtgcaagc cggcgaccaa       300
     acctcgctca gtgatgccat caaacggagc ttggagctaa cagcccagct gtccggccat       360
     gcacacgggc caagtgcagg cgcgggtaag gtcatcacta tcttttcggc aaagggaggc       420
     gtcggtaaga ccacgctggc cacgaatctt gcggcctatc ttgcctcgac cggggcggag       480
     acgctgctta tcgaccttga cctcatgttc ggcgatgtcg cgatcagcct ccaagtagtc       540
     cccgcccacg acatcggtca cctgatcagc atgcggggcc atctcgatga acaaggtgtg       600
     cattccgtgg tgagtcggca cgaggacagc ggccttgctg tcatcgccgc tccctcggac       660
     cctgaagtag ccgaccgcgt tccggcagcg gttgtcgaag agctcctccg cgtcgcccgg       720
     ggaatgttcg cctatgtcat tgtcgacacc cctccgaacc tgaccgagca cgtccttacg       780
     gcatgcgacc tcagcgatct gaccatgctg gtggctaccc tggacatccc tgcggtcaag       840
     aacctacggg ttgccatgaa cgccttggac actctcgggg cgtccaagga cgggcgtgtc       900
     atcgtgttga accgatccga cgcgaaggtt gggctcaagg ccgacgacgt ggaggtggca       960
     ctgcaacatg agatccgtgg gcaggtgccg acaagccagt cggtgccgtc ctccgtcaac      1020
     cgaggggtgg ccctcgtcct cgacgaaccg cggtctccgg tcgccgtcgc gattcgggag      1080
     atcgctgacc gggagatccg ttctcgattt ggcgagcagg tcgagaacgg gtcgagacgc      1140
     ggattcgcat tgttgaggag ccggaagtga                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page