(data stored in SCRATCH zone)

EMBL: CP002343.PE489

CP002343.PE489       Location/Qualifiers
FT   CDS_pept        545057..547015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0505"
FT                   /product="Type II secretion system F domain"
FT                   /note="COGs: COG4965 Flp pilus assembly protein TadB;
FT                   InterPro IPR002035: IPR018076; KEGG: tcu:Tcur_1851 type II
FT                   secretion system protein; PFAM: Type II secretion system F
FT                   domain; von Willebrand factor type A; SMART: von Willebrand
FT                   factor type A; SPTR: Putative membrane protein; PFAM: von
FT                   Willebrand factor type A domain; Bacterial type II
FT                   secretion system protein F domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47051"
FT                   /db_xref="GOA:E6S8T2"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8T2"
FT                   /protein_id="ADU47051.1"
FT                   /translation="MTRSLRRLWIGLAALLLLLFLARPAAAASIDAVMSDVKSSSGTVT
FT                   GVLTVRSANPVQVDPGSVKASVDGVIVKSFVSEMTHTKRTAMLVIDTSGSMGTDGMATV
FT                   RAATRAYLKEAPEDVLIGVVTFANTAGVDLKPTVDRAAAQRVVNGLDARGDTSLYAAVR
FT                   SAARAMPGDGDRSMVLLSDGADTVSDDRQGDLAEANRELKRRGVRVDVVRFNTDDPDAV
FT                   VALRSFASASGGSVIPATNASDVGAAFKSAARALRSQAQFTLTPSSPLQGNHTITISGT
FT                   AAGEPFKTTQTVNFGEVAAVMTPAAPPPAGPAGAALPPLHALTMQASLMPWIAAGTIGV
FT                   AILLLAIGILTPSFATRREQRLASLESYMGQTRVASRSEGKHHSAPIAEQLVNFGERAM
FT                   KGRSSTARTMELINRADLPLRPGEWWVLRSVAVLSGVAIGMLLFGGSALLGAALGFMLG
FT                   YFLPAFVLRFLAARRAAAFERLLPQSLMLVSTSLRSGFGLPQALDSIAKDAPDPLAKEF
FT                   SRGLAETRIGTDIADALERMADRMGSRSMRMAVMAIRIQREVGGNLAETLETTARTLRE
FT                   RESLHRQVRALSAEGRLSAYILIALPIGLFFYMMWVNYGYISLLWTHPLGLMMLVGGIV
FT                   LLIGGIFWMRQVVKIEV"
     gtgacccgtt cgctccgcag gctctggatt gggctggccg cgcttctcct gctcctgttt        60
     ctggctcgac cagcggcggc ggcatccatt gacgcagtca tgagtgacgt caagtcctct       120
     tcaggcacag tcaccggggt tctcacagtc aggagcgcca accccgtcca agtggacccg       180
     gggagtgtga aggcatccgt ggatggagtg atcgtcaaat ccttcgtctc cgaaatgacg       240
     cacacaaagc gcacggcgat gctcgtcata gacaccagcg ggtcgatggg gacggacggc       300
     atggccaccg ttcgtgccgc aactcgcgcc tacctcaagg aggcccccga agacgtcttg       360
     atcggggtcg tcacctttgc caacaccgcc ggcgtcgacc tcaaacccac tgttgatcgt       420
     gcggccgcgc agcgagtcgt aaatggcttg gacgcccgcg gagatacgag cctgtatgcg       480
     gcagtccgtt cggcggcgcg cgccatgccc ggtgatggag atcgaagcat ggtcttgctg       540
     agcgacggcg cagatacggt gagcgacgac cggcagggtg atctcgctga agcgaacaga       600
     gagttgaagc ggcgcggtgt ccgagtggat gtcgtgcgtt tcaacactga tgacccggat       660
     gccgtcgtcg cactccggag cttcgccagt gcgagcggcg gctcggtcat cccggccacc       720
     aacgcatcgg acgtgggagc tgcgttcaag tcggcggctc gcgccctcag gtcccaagcc       780
     cagttcacct tgacgcccag ttcccctctc cagggcaacc acaccatcac gatctcgggt       840
     acggctgctg gcgagccatt caagacaact caaaccgtga atttcggaga agttgccgca       900
     gtgatgacac cagccgcgcc gccgccggct ggccccgctg gagcggctct accacccctg       960
     cacgctctta cgatgcaggc gtcgttgatg ccgtggatcg cggccggcac catcggggtg      1020
     gccatcctgc tccttgccat cggtatcctg acgcctagct ttgcgacccg gcgtgagcaa      1080
     cgacttgctt cgctcgaaag ctacatgggg cagacgagag tcgcgtctcg atcggagggc      1140
     aagcaccatt ccgcgcccat tgcggagcag ctcgtcaact ttggcgagcg cgctatgaag      1200
     ggccgctcgt caactgcgcg aacgatggag ctgatcaacc gggccgatct gccgcttcga      1260
     ccgggtgaat ggtgggtcct ccgcagcgtg gctgtgctga gcggcgtagc gatcggcatg      1320
     ctgctgttcg gtggatcggc cttgctcggt gctgctctgg gattcatgct cggctacttc      1380
     cttccagctt tcgtgcttcg cttcctcgcg gcgcggcggg cggcagcatt cgagcgcctc      1440
     ctgccgcagt ccctgatgct tgtctcgacg agtctgcgga gcggttttgg actgccccag      1500
     gcccttgact cgatcgccaa agacgcccca gatcccctcg caaaggaatt ctctagaggc      1560
     ctggcagaga ccaggatcgg caccgacatc gccgatgcct tggaacgcat ggcggaccgc      1620
     atgggcagca ggtcgatgcg gatggcagtg atggcgatcc gcatccagcg agaggtgggc      1680
     ggcaacctcg ccgagaccct ggagaccacg gcgagaaccc tccgtgagcg ggagtccctc      1740
     catcgccaag tgcgagccct ttctgctgag ggccgtctgt ctgcctacat cctgatcgct      1800
     ctcccgatcg gcctcttctt ctacatgatg tgggtcaatt atggctacat ctcgctgctc      1860
     tggacccacc cgttgggcct gatgatgctc gttggaggaa tcgttcttct cattggagga      1920
     atcttctgga tgcggcaagt cgtaaagatc gaggtgtga                             1959
//

If you have problems or comments...

PBIL Back to PBIL home page