(data stored in ACNUC7421 zone)

EMBL: CP002343.PE49

CP002343.PE49        Location/Qualifiers
FT   CDS_pept        complement(54559..55689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0049"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="COGs: COG0247 Fe-S oxidoreductase; InterPro
FT                   IPR004017: IPR012257: IPR017900: IPR017896; KEGG:
FT                   gob:Gobs_0251 protein of unknown function DUF224
FT                   cysteine-rich region domain protein; PFAM: protein of
FT                   unknown function DUF224 cysteine-rich region domain
FT                   protein; SPTR: Putative uncharacterized protein; PFAM:
FT                   Cysteine-rich domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46611"
FT                   /db_xref="GOA:E6SEL0"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEL0"
FT                   /protein_id="ADU46611.1"
FT                   /translation="MTDRGLFDKDLLAACISCGFCLPACPTYAMTQDERSSPRGRITLM
FT                   RALETGRLEEDDPTLQEQASFCLGCRACETVCPAGVQYGALLEQWRDHQWRGRHVPPAA
FT                   LALRAGMRATPLIEAAGRVRGAARPTGPARADAAAHLMLGCAERAMFPQLSRAVLRLLP
FT                   DVVDVPSGQGCCGALHAHNGDSTTAHRMAEDLGKVMPGVILTTAGGCGAHIAQVLGRDR
FT                   VRELSEFLLQYWGEHPDRLPPLGRVTVDGRPVRAALQDSCHLRNGLHVTAEPRELIARV
FT                   ADYVELPSAGTCCGAAGTYSILRPEDSQRVLDIHLDEIEAADLDYLIVVNMPCQRQMIN
FT                   GLKRRRSKVRVLHLAELLAAALDVGERERAPSQPPT"
     atgacggacc gcggcctctt cgacaaggac ctgctcgcgg cgtgcatctc ctgcggtttc        60
     tgcctgcccg cgtgcccgac gtacgccatg acgcaggacg agcgatccag cccgcgcggc       120
     cggatcacgc tgatgcgcgc cctcgagacg ggtcggctcg aggaggacga cccgaccctg       180
     caggagcagg cctcgttctg tctcgggtgc cgcgcctgcg agacggtctg cccggccggc       240
     gtgcagtacg gcgcgctcct cgagcagtgg cgcgaccacc agtggcgcgg gcggcacgtc       300
     ccgcccgccg ccctggccct gcgagccggg atgcgggcca cccccctcat cgaggcggcc       360
     ggccgcgtgc gcggggccgc gaggccgacg ggcccggcac gtgccgacgc cgcggcgcac       420
     ctcatgctcg gctgcgccga gcgggcgatg ttcccgcagc tctcgagggc ggtcctcagg       480
     ctgctccccg acgtcgtcga cgtcccgtcc gggcagggct gctgcggggc gctgcacgcc       540
     cacaacggcg actcgacgac cgcccaccgg atggccgagg acctcggcaa ggtcatgccc       600
     ggcgtgatcc tgacgaccgc cggcggctgc ggggcgcaca tcgcgcaggt gctcgggcgc       660
     gaccgggtcc gggagctgtc cgagttcctc ctccagtact ggggcgagca ccccgaccgg       720
     ctgcctcccc tcggccgggt cacggtcgac ggtcgtcccg tccgggccgc gctccaggac       780
     tcctgccacc tgcgcaacgg cctccacgtc acggccgagc cgagggagct catcgcgcgg       840
     gtcgccgact acgtcgagct cccgtcggcc ggcacctgct gcggcgcggc cgggacgtac       900
     tcgatcctcc ggccggagga ctcgcagcgc gtcctcgaca tccacctcga cgagatcgag       960
     gcggccgacc tcgactacct catcgtcgtc aacatgccgt gccagcgcca gatgatcaac      1020
     ggcctcaagc gccgccgctc gaaggtgcgg gtcctccacc tcgccgaact gctcgccgcc      1080
     gcgctcgacg tcggggagcg ggagcgcgct ccctcccagc cgcccacctg a               1131
//

If you have problems or comments...

PBIL Back to PBIL home page