(data stored in ACNUC7421 zone)

EMBL: CP002343.PE490

CP002343.PE490       Location/Qualifiers
FT   CDS_pept        547017..547937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0506"
FT                   /product="Type II secretion system F domain"
FT                   /note="COGs: COG2064 Flp pilus assembly protein TadC;
FT                   InterPro IPR018076; KEGG: tcu:Tcur_1850 type II secretion
FT                   system protein; PFAM: Type II secretion system F domain;
FT                   SPTR: Probable secretion system protein TadC; PFAM:
FT                   Bacterial type II secretion system protein F domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47052"
FT                   /db_xref="GOA:E6S8T3"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8T3"
FT                   /protein_id="ADU47052.1"
FT                   /translation="MASVYIGVGLIAVAVFGLVLALSFGSGGPTGVAKSLAMIEGVVTQ
FT                   RSAVKTELDAKDRLVEPIFNRAQRIATVLSPQGTSDRLARGLERAGNPSPWTAERVMGA
FT                   KGVALLIGLLLGVAYGGFSLRGFVFALGFGGAAFWLPNLLVYNAALRRQEQVATGLAEA
FT                   LDMLTVCVEAGQGFDAALVQVARSTDGPISGEFARVLSEVQIGKSRSEAFAGLGDRVSL
FT                   SDVKNFVSAIIQADKLGIPIASVLREQTAAMRLSRRQRAEEKAQKVTVKILFPLLLCIF
FT                   PAMFVVILGPGIIRMITTLFGGNLL"
     gtggcgagtg tttacatcgg cgtcggcttg atcgccgtcg cagtcttcgg ccttgtgctg        60
     gctctcagct tcggctcagg cggaccaacc ggggtggcta agtctttggc catgatcgag       120
     ggagtcgtca cccagcgctc cgccgtcaag accgagcttg atgcgaaaga ccgcctggtc       180
     gagccgatct tcaaccgggc gcaacggatc gccacggtcc tctcgccaca agggacgagc       240
     gatcggctgg ctcgtgggct cgagcgggcg ggcaacccct cgccctggac tgccgaacgc       300
     gtcatgggag ctaagggcgt cgcattgctc ataggcctgc tgctaggtgt ggcttatggc       360
     ggattttccc tgagaggctt cgtctttgca ctggggttcg gtggagcggc gttctggctg       420
     cccaatcttc tcgtgtacaa cgccgctttg cggcggcagg agcaggtggc caccggcttg       480
     gcagaggcgc tggacatgct cacggtctgt gtggaggccg gtcaaggctt tgacgccgcg       540
     ctcgtccagg ttgccaggtc gactgatggg ccgatctccg gcgaattcgc gcgcgtcctg       600
     tccgaggtcc agatcggcaa gtcgcgttct gaggccttcg ccggcttggg tgaccgcgtg       660
     tccctatcag acgtcaagaa cttcgtgtcg gccatcatcc aagcagacaa gctgggcatc       720
     ccgatcgcgt ctgtgcttcg cgagcagacg gctgcgatgc gtctctcacg tcgtcagagg       780
     gcggaggaga aggcgcagaa agtcacggtg aagatcctct ttcccctgct gctgtgcatc       840
     ttcccagcga tgttcgttgt gattctcggg cccggtatca ttcgaatgat cactacactc       900
     tttggcggca acctcttgta a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page