(data stored in ACNUC7421 zone)

EMBL: CP002343.PE491

CP002343.PE491       Location/Qualifiers
FT   CDS_pept        complement(548041..549276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0507"
FT                   /product="cupin 4 family protein"
FT                   /note="InterPro IPR003347; KEGG: gob:Gobs_3279 cupin 4
FT                   family protein; SPTR: Cupin 4 family protein; PFAM: Cupin
FT                   superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47053"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR039994"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8T4"
FT                   /protein_id="ADU47053.1"
FT                   /translation="MSLTTQSRGSAPTRRPSALPRLVSVPVDEFASDHWGRQPLVSLGA
FT                   DLAGGFEDLFSLEAVDELVSRRGLRTPFVRVAKNGQTLPDSAFTAGGGVGAGIADQVSD
FT                   DKLLRLFADGATIVLQGLHRTWAPVSDFVAALAEDLGHPVQANAYVTPRQSQGFNDHYD
FT                   VHDVFVLQVAGEKHWRIRLPVHLWPTRDQPWTAYRERVGQAAAEPPLLDVTLRAGDCLY
FT                   LPRGFLHSATATEEVSAHLTLGVHTWTRAHLAEALVAEAMHALVDAESERAPLPLGVDV
FT                   GNPAGVADEVTRLREVLAGLVEGIDPDRVAARLGRQARAAARPGPLSPVAQARRALQLG
FT                   PDDVIRLRGFVRPEVIDGPDGGAVVQSRAGSLTVTADERPAIETLLAQGEAPVSTLGLD
FT                   LARRLLTAGLAL"
     atgtccctga ccacgcagag ccgggggtcg gcgccgacgc gtcgaccttc ggccctgccg        60
     cggctcgtct cggtcccggt cgacgagttc gcctctgacc actggggccg acagccgctc       120
     gtgtcgctcg gggccgacct cgccggaggg ttcgaggacc tcttctccct ggaggcggtc       180
     gacgagctcg tgtcgcggcg cgggctgcgg actccgttcg tccgggtggc gaagaacggg       240
     cagaccctgc cggactcggc cttcaccgcg ggtgggggcg tcggggccgg gatcgccgac       300
     caggtcagtg acgacaagct gctccggctc ttcgccgacg gtgcgaccat cgtcctccag       360
     ggcctgcacc gcacctgggc accggtcagc gacttcgtcg cagcgctggc cgaggacctc       420
     gggcaccccg ttcaggccaa tgcctatgtg acaccgcgac agagccaggg cttcaacgac       480
     cactacgacg tgcacgacgt gttcgtcctg caggtcgcgg gcgagaaaca ctggcggatc       540
     aggctgcccg tccacctctg gcccacgcgg gaccagccgt ggaccgcgta tcgcgagcgg       600
     gtgggtcagg ctgctgctga gcctccgctg ctcgacgtca cgctgcgggc cggcgactgc       660
     ctctacctgc cccgcggctt cctgcactcc gccacggcca cggaggaggt gagcgcccac       720
     ctcacgctcg gcgtgcacac ctggacgcgg gcgcacctgg ccgaggctct ggtcgccgag       780
     gcgatgcacg ctctcgtgga cgccgagtcg gagcgcgctc ccctgccgct cggcgtggac       840
     gtgggcaatc cggctggcgt tgcggacgag gtcacccgcc tgcgtgaggt gctcgccggc       900
     ctggtcgagg gcatcgatcc cgaccgcgtc gccgcccggc tcggacggca ggcccgtgcg       960
     gcggccagac ccggtcctct cagcccggtg gcacaggcac gtcgggccct gcagctcggc      1020
     cccgacgacg tgatccggct gcgcggcttc gtccggccgg aggtcatcga cggtccggac      1080
     ggcggtgcag tggtccagag ccgggccggg tccctgaccg tcactgccga cgagcggcct      1140
     gcgatagaga cgctgctcgc gcagggcgag gctcctgtct cgaccctcgg cctcgacctg      1200
     gcccgccgcc tcctcaccgc cggcttggcc ctgtaa                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page